(data stored in ACNUC7421 zone)

EMBL: AM286690.RLUD

AM286690.RLUD        Location/Qualifiers
FT   CDS             517349..518320
FT                   /transl_table=11
FT                   /gene="rlud"
FT                   /locus_tag="ABO_0476"
FT                   /product="pseudouridylate synthase"
FT                   /function="responsible for synthesis of pseudouridine from
FT                   uracil at two positions in 23s ribosomal RNA (uracil +
FT                   d-ribose 5-phosphate = pseudouridine 5'-phosphate + H(2)O"
FT                   /EC_number="4.2.1.70"
FT                   /note="ThrB family protein/aminotransferase class III)
FT                   identified by sequencesimilarity; putative InterPro:
FT                   Pseudouridine synthase Rlu family"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15924"
FT                   /db_xref="GOA:Q0VSC4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSC4"
FT                   /protein_id="CAL15924.1"
FT                   /translation="MGHLGGEKIQRTEQVKPEHAGQRVDQVAAELFEGFSRSRLQTWIK
FT                   NGVLTVNGAQTKPKEKLTGNESLTLEVEIEPELDDQPQSIDLDVVYQDDDLIVINKPTG
FT                   LVVHPAAGHADGTLLNGLLHLDERLNSLPRAGIVHRLDRDTTGLMVVARSLEAHQSLVA
FT                   QLQDKSLFRQYEAIAVGVMTGGGKVDAPMGRHPVDRKKQAVVKTGGKNAVTHYRVLDRY
FT                   RAHTRIQVQLETGRTHQIRVHMAHRNYPLVGDPLYGGRLKQPAGATEALRQALHKFPRQ
FT                   ALHARKLGLIHPARGEYCEFQAELPADMTSLIVALENDIKDE"
     MGHLGGEKIQ RTEQVKPEHA GQRVDQVAAE LFEGFSRSRL QTWIKNGVLT VNGAQTKPKE        60
     KLTGNESLTL EVEIEPELDD QPQSIDLDVV YQDDDLIVIN KPTGLVVHPA AGHADGTLLN       120
     GLLHLDERLN SLPRAGIVHR LDRDTTGLMV VARSLEAHQS LVAQLQDKSL FRQYEAIAVG       180
     VMTGGGKVDA PMGRHPVDRK KQAVVKTGGK NAVTHYRVLD RYRAHTRIQV QLETGRTHQI       240
     RVHMAHRNYP LVGDPLYGGR LKQPAGATEA LRQALHKFPR QALHARKLGL IHPARGEYCE       300
     FQAELPADMT SLIVALENDI KDE                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page