(data stored in ACNUC7421 zone)

EMBL: AM286690.RPLB

AM286690.RPLB        Location/Qualifiers
FT   CDS             450429..451253
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="ABO_0400"
FT                   /product="50S ribosomal protein L2"
FT                   /function="This protein is a primary 23S rRNA-binding
FT                   protein. It has peptidyltransferase activity."
FT                   /note="(ribosomal protein L2) identified by
FT                   sequencesimilarity; putative InterPro: Ribosomal protein
FT                   L2"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15848"
FT                   /db_xref="GOA:Q0VSK0"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSK0"
FT                   /protein_id="CAL15848.1"
FT                   /translation="MAIVKCKPTSPGRRFVVKVVNEDLHKGAPYAPLLEAKAKNGGRNN
FT                   NGRITTRHKGGGHKQKYRVIDFRRNKDGIAGVVERLEYDPNRTAHIALVKYLDGERRYI
FT                   LAPKGLKAEDRIQSGEDAPIKLGNALPLRNIPLGSTIHNVEMKPGKGGQIARSAGTSVQ
FT                   LLAKDGQYVTLRLRSGEMRKVHADCKATIGEVSNSEHSLRSLGKAGAKRWRGVRPTVRG
FT                   AAMNPVDHPHGGGEGRSSGGRHPVTPWGVPTKGYKTRTNKRTTKMIVRDRRK"
     MAIVKCKPTS PGRRFVVKVV NEDLHKGAPY APLLEAKAKN GGRNNNGRIT TRHKGGGHKQ        60
     KYRVIDFRRN KDGIAGVVER LEYDPNRTAH IALVKYLDGE RRYILAPKGL KAEDRIQSGE       120
     DAPIKLGNAL PLRNIPLGST IHNVEMKPGK GGQIARSAGT SVQLLAKDGQ YVTLRLRSGE       180
     MRKVHADCKA TIGEVSNSEH SLRSLGKAGA KRWRGVRPTV RGAAMNPVDH PHGGGEGRSS       240
     GGRHPVTPWG VPTKGYKTRT NKRTTKMIVR DRRK                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page