(data stored in ACNUC7421 zone)

EMBL: AM286690.RPLJ

AM286690.RPLJ        Location/Qualifiers
FT   CDS             417866..418396
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="ABO_0376"
FT                   /product="50S ribosomal protein L10"
FT                   /function="Protein L10 is also a translational repressor
FT                   protein, it controls the translation of the rpljl-rpoBC
FT                   operon by binding to its mRNA."
FT                   /note="(ribosomal protein L10) identified by
FT                   sequencesimilarity; putative InterPro: Ribosomal protein
FT                   L10"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15824"
FT                   /db_xref="GOA:Q0VSM4"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSM4"
FT                   /protein_id="CAL15824.1"
FT                   /translation="MPLNLEDKRAIVASVNAVAAEALSAVVADYRGLTVSQMTELRSKA
FT                   RETGVYLKVVRNTLAKFAVKDTEFECLNDALVGPTVLAFSKDDPGAAARLIKDFAKDHD
FT                   ALEVKALAVGGVTYGAQDIDVLAKLPTRDEAISQLMSVMQAPVAKFVRTLNEVPGKFVR
FT                   TVAAVKDQKQSAA"
     MPLNLEDKRA IVASVNAVAA EALSAVVADY RGLTVSQMTE LRSKARETGV YLKVVRNTLA        60
     KFAVKDTEFE CLNDALVGPT VLAFSKDDPG AAARLIKDFA KDHDALEVKA LAVGGVTYGA       120
     QDIDVLAKLP TRDEAISQLM SVMQAPVAKF VRTLNEVPGK FVRTVAAVKD QKQSAA           176
//

If you have problems or comments...

PBIL Back to PBIL home page