(data stored in ACNUC7421 zone)

EMBL: AM286690.RPLK

AM286690.RPLK        Location/Qualifiers
FT   CDS             416432..416860
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="ABO_0374"
FT                   /product="50S ribosomal protein L11"
FT                   /function="This protein binds directly to 23S ribosomal
FT                   RNA."
FT                   /note="(ribosomal protein L11) identified by
FT                   sequencesimilarity; putative InterPro: Ribosomal protein
FT                   L11"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15822"
FT                   /db_xref="GOA:Q0VSM6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSM6"
FT                   /protein_id="CAL15822.1"
FT                   /translation="MAKKVQAYIKLQVAAGQANPSPPVGPALGQHGVNIMEFCKAFNAQ
FT                   TQQLDAGAPVPVVITVYNDRSFTFTMKTPPAAYLLKKAAGIKSGSGEPNTKKVGKVTRA
FT                   QLEEIAKAKEPDLTAADMDAAVRTIAGSARSMGLDVEG"
     MAKKVQAYIK LQVAAGQANP SPPVGPALGQ HGVNIMEFCK AFNAQTQQLD AGAPVPVVIT        60
     VYNDRSFTFT MKTPPAAYLL KKAAGIKSGS GEPNTKKVGK VTRAQLEEIA KAKEPDLTAA       120
     DMDAAVRTIA GSARSMGLDV EG                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page