(data stored in ACNUC7421 zone)

EMBL: AM286690.RPLM

AM286690.RPLM        Location/Qualifiers
FT   CDS             635264..635692
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="ABO_0576"
FT                   /product="50S ribosomal protein L13"
FT                   /function="This protein is one of the early assembly
FT                   proteins of the 50S ribosomal subunit."
FT                   /note="(ribosomal protein L13) identified by
FT                   sequencesimilarity; putative InterPro: Ribosomal protein
FT                   L13"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16024"
FT                   /db_xref="GOA:Q0VS24"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VS24"
FT                   /protein_id="CAL16024.1"
FT                   /translation="MKTYSAKPESVKRDWYVVDASGKTLGRLATEVASRLRGKHKPEFT
FT                   PHVDTGDYIVVINADKVAVTGKKASDKMYYRHTGYPGGLKEANFATLQAEKPEMIIEKA
FT                   IKGMLPRNPLGRAMFRKLKVYAGTEHPHTAQQPQQLEI"
     MKTYSAKPES VKRDWYVVDA SGKTLGRLAT EVASRLRGKH KPEFTPHVDT GDYIVVINAD        60
     KVAVTGKKAS DKMYYRHTGY PGGLKEANFA TLQAEKPEMI IEKAIKGMLP RNPLGRAMFR       120
     KLKVYAGTEH PHTAQQPQQL EI                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page