(data stored in ACNUC7421 zone)

EMBL: AM286690.RPLN

AM286690.RPLN        Location/Qualifiers
FT   CDS             453543..453911
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="ABO_0407"
FT                   /product="50S ribosomal protein L14"
FT                   /function="This protein binds directly to 23S ribosomal
FT                   RNA."
FT                   /note="(ribosomal protein L14) identified by sequence
FT                   similarity;putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15855"
FT                   /db_xref="GOA:Q0VSJ3"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSJ3"
FT                   /protein_id="CAL15855.1"
FT                   /translation="MIQTESMLEVADNSGARRVQCIKVLGGSHRRYAGIGDIIKVTVKE
FT                   AIPRGRVKKGDVMTAVVVRTRKGVRRPDGSLIRFDENAAVLLNNNKAPVGTRIFGPVTR
FT                   ELRTEQFMKIISLAPEVL"
     MIQTESMLEV ADNSGARRVQ CIKVLGGSHR RYAGIGDIIK VTVKEAIPRG RVKKGDVMTA        60
     VVVRTRKGVR RPDGSLIRFD ENAAVLLNNN KAPVGTRIFG PVTRELRTEQ FMKIISLAPE       120
     VL                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page