(data stored in ACNUC7421 zone)

EMBL: AM286690.RPLP

AM286690.RPLP        Location/Qualifiers
FT   CDS             452617..453030
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="ABO_0404"
FT                   /product="50S ribosomal protein L16"
FT                   /function="This protein binds directly to 23S ribosomal RNA
FT                   and is located at the a site of the peptidyltransferase
FT                   center."
FT                   /note="(ribosomal protein L16) identified by match to PFAM
FT                   protein family HMMPF00252 InterPro: Ribosomal protein L16"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15852"
FT                   /db_xref="GOA:Q0VSJ6"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSJ6"
FT                   /inference="protein motif:HMMPFAM:HMMPF00252"
FT                   /protein_id="CAL15852.1"
FT                   /translation="MLQPKRTKFRKVMKGRNRGLAQRGSKVSFGTIGLQATGRGRITAR
FT                   QIEAARRAMTRHIKRGGKIWIRVFPDKPITNKPLEVRMGKGKGSVEYWVAQIQPGKMLY
FT                   EMEGVSEDVAREAFRLAAAKLPVSTRVVTRTVM"
     MLQPKRTKFR KVMKGRNRGL AQRGSKVSFG TIGLQATGRG RITARQIEAA RRAMTRHIKR        60
     GGKIWIRVFP DKPITNKPLE VRMGKGKGSV EYWVAQIQPG KMLYEMEGVS EDVAREAFRL       120
     AAAKLPVSTR VVTRTVM                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page