(data stored in ACNUC7421 zone)

EMBL: AM286690.RPLR

AM286690.RPLR        Location/Qualifiers
FT   CDS             456115..456465
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="ABO_0413"
FT                   /product="50S ribosomal protein L18"
FT                   /function="This is one of 3 proteins that mediate the
FT                   attachment of the 5S RNA into the large ribosomal subunit"
FT                   /note="(ribosomal protein L18) identified by sequence
FT                   similarity; putative InterPro: Ribosomal protein L18P/L5E"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15861"
FT                   /db_xref="GOA:Q0VSI7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSI7"
FT                   /protein_id="CAL15861.1"
FT                   /translation="MKDKKVARLRRAKRTRLKIRELGEVRLCVHRTPRHIYAQVISAAG
FT                   DQVLASASTVEKDLRADATGNADAATKVGQIIAQRAKEAGIERVAFDRSGFKYHGRVKA
FT                   LADAARENGLEF"
     MKDKKVARLR RAKRTRLKIR ELGEVRLCVH RTPRHIYAQV ISAAGDQVLA SASTVEKDLR        60
     ADATGNADAA TKVGQIIAQR AKEAGIERVA FDRSGFKYHG RVKALADAAR ENGLEF           116
//

If you have problems or comments...

PBIL Back to PBIL home page