(data stored in ACNUC7421 zone)

EMBL: AM286690.RPLU

AM286690.RPLU        Location/Qualifiers
FT   CDS             492441..492776
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="ABO_0452"
FT                   /product="50S ribosomal protein L21"
FT                   /function="This protein binds to 23S ribosomal RNA in the
FT                   presence of protein L20."
FT                   /note="(ribosomal protein L21) identified by sequence
FT                   similarity; putative InterPro: Ribosomal protein L21"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15900"
FT                   /db_xref="GOA:Q0VSE8"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSE8"
FT                   /protein_id="CAL15900.1"
FT                   /translation="MELCWSTHMYAVIKTGGKQYRVEEGDVVRIEKIEVATGESVDFDQ
FT                   VLLVANGDDVKVGQPMLDGAKVTAEVLEQGRHKKIKIVKFRRRKHSRKQQGHRQWYTAV
FT                   KITGIQG"
     MELCWSTHMY AVIKTGGKQY RVEEGDVVRI EKIEVATGES VDFDQVLLVA NGDDVKVGQP        60
     MLDGAKVTAE VLEQGRHKKI KIVKFRRRKH SRKQQGHRQW YTAVKITGIQ G                111
//

If you have problems or comments...

PBIL Back to PBIL home page