(data stored in ACNUC7421 zone)

EMBL: AM286690.RPLX

AM286690.RPLX        Location/Qualifiers
FT   CDS             453927..454235
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="ABO_0408"
FT                   /product="50S ribosomal protein L24"
FT                   /function="This protein is found in the ribonucleoprotein
FT                   core and is involved in the early assembly of the 50S
FT                   subunit. It is not involved in the functions of the mature
FT                   50S subunit."
FT                   /note="(ribosomal protein L24) identified by
FT                   sequencesimilarity; putative InterPro: Ribosomal protein
FT                   L24"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15856"
FT                   /db_xref="GOA:Q0VSJ2"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSJ2"
FT                   /protein_id="CAL15856.1"
FT                   /translation="MLKIKRDDEIIVIAGKDKGKRGSVQQVLDNGRLIVAGVNMVKKHV
FT                   KANPNRGTQGGIVEQEASLNASNVAIWNPKTQKADRVGFRFEDGKKVRFFKSNGEAL"
     MLKIKRDDEI IVIAGKDKGK RGSVQQVLDN GRLIVAGVNM VKKHVKANPN RGTQGGIVEQ        60
     EASLNASNVA IWNPKTQKAD RVGFRFEDGK KVRFFKSNGE AL                          102
//

If you have problems or comments...

PBIL Back to PBIL home page