(data stored in ACNUC7421 zone)

EMBL: AM286690.RPLY

AM286690.RPLY        Location/Qualifiers
FT   CDS             complement(568328..568972)
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /locus_tag="ABO_0517"
FT                   /product="50S ribosomal protein L25"
FT                   /function="Binds to the 5S rRNA"
FT                   /note="(ribosomal 5S rRNA E-loop binding
FT                   proteinCtc/L25/TL5) identified by match to PFAM protein
FT                   family HMMPF01386 InterPro: Ribosomal protein L25"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15965"
FT                   /db_xref="GOA:Q0VS83"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VS83"
FT                   /inference="protein motif:HMMPFAM:HMMPF01386"
FT                   /protein_id="CAL15965.1"
FT                   /translation="MSNEFLLNAESRSDTGKGASRRLRRLQERVPGILYGGEAEPQMIS
FT                   VELRELKKALENEAFYSHILTLKLDGADVQAVLRDMQRHPAKGHPLHVDLLRVDKTHKI
FT                   TMSVPLHFTNEESSIGVKKQGGEIQHNFAEVEVSCLPQHLPEFIEVDMANAELDSVVHL
FT                   SDLKLPKGVELTQLALGEDHDQPVAAVHQPKVRASSDDDDAAEGEEAASEE"
     MSNEFLLNAE SRSDTGKGAS RRLRRLQERV PGILYGGEAE PQMISVELRE LKKALENEAF        60
     YSHILTLKLD GADVQAVLRD MQRHPAKGHP LHVDLLRVDK THKITMSVPL HFTNEESSIG       120
     VKKQGGEIQH NFAEVEVSCL PQHLPEFIEV DMANAELDSV VHLSDLKLPK GVELTQLALG       180
     EDHDQPVAAV HQPKVRASSD DDDAAEGEEA ASEE                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page