(data stored in ACNUC7421 zone)

EMBL: AM286690.RPMB

AM286690.RPMB        Location/Qualifiers
FT   CDS             233902..234138
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="ABO_0215"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by sequencesimilarity; putative InterPro:
FT                   Ribosomal protein L28"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15663"
FT                   /db_xref="GOA:Q0VT57"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VT57"
FT                   /protein_id="CAL15663.1"
FT                   /translation="MSKVCQVTGKRPVTGNRVSHSNIKTKRRFEPNLHHHRFWVESEKR
FT                   FVRLRVSSKGMRIIDKKGIDSVLADIRSRGNRV"
     MSKVCQVTGK RPVTGNRVSH SNIKTKRRFE PNLHHHRFWV ESEKRFVRLR VSSKGMRIID        60
     KKGIDSVLAD IRSRGNRV                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page