(data stored in ACNUC7421 zone)

EMBL: AM286690.RPMG

AM286690.RPMG        Location/Qualifiers
FT   CDS             234161..234328
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="ABO_0216"
FT                   /product="ribosomal protein L33"
FT                   /note="identified by sequencesimilarity; putative InterPro:
FT                   Ribosomal protein L33"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15664"
FT                   /db_xref="GOA:Q0VT56"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VT56"
FT                   /protein_id="CAL15664.1"
FT                   /translation="MAGPIREKIRLVSSAGTGHFYTTTKNKRLHPEKMETKKYDPVVRK
FT                   HVAYKEAKIK"
     MAGPIREKIR LVSSAGTGHF YTTTKNKRLH PEKMETKKYD PVVRKHVAYK EAKIK             55
//

If you have problems or comments...

PBIL Back to PBIL home page