(data stored in ACNUC7421 zone)

EMBL: AM286690.RPOC

AM286690.RPOC        Location/Qualifiers
FT   CDS             423222..427424
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="ABO_0379"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /function="DNA-directed RNA polymerase beta' subunit/160 kD
FT                   subunit (split gene in archaea and Syn)"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by sequencesimilarity; putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15827"
FT                   /db_xref="GOA:Q0VSM1"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSM1"
FT                   /protein_id="CAL15827.1"
FT                   /translation="MKDLLNLLKSQGQVTEFDKIRIALAPPDLIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPIKDYECLCGKYKRLKHRGVICEKCGVEVTLSKVRRERMGH
FT                   IELASPTAHIWFLKSLPSRIGLMLDMTLRDIERVLYFESFVVTEPGMTTLERGQLLTDE
FT                   EYFDAMEEFGDEFEAKMGAEAVQQLLMELDLVEEIKILREEVESTNSDTKLKKLSKRLK
FT                   LMEAFKDSGNAPEWMVLTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLSAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVIVVGPTLKLHECGLPKKMALELFKPFIFAKLEGRGLATTIKAAKK
FT                   MVERETAEVWDILAEVIREHPVMLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAFN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIGPTQDVVLGLYYISRDR
FT                   VNAQGEGHVFADTKEVMRALGNKQVHIHARVKVRVHEVVKDLEGNVEERTFIADTTPGR
FT                   CKLWDIVPAGLGFDMVNQNMTKKAISKLLNTCYRILGTKETCIFADQLMYLGFREATLS
FT                   GSSIGVEDMVIPDAKYTMIDAAEEEVREIEEQFASGLVTRGERYNKVVDIWARTNDQIA
FT                   KAMMENLRVEVVKNRDGKDEEQGSFNSIFMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITSNFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVNHI
FT                   DCGTEEGLLMTPLIEGGDVVEPLRERVLGRVVARDVMNPLNQDEVAVEAGTLLDEVWVA
FT                   QLETMGVDEVLVRSPITCATRWGVCATCYGRDLARGHQVNVGEAVGVIAAQSIGEPGTQ
FT                   LTMRTFHIGGAASRASAVSSIQIKHGGKVRFHNAKHVQHKDGLVIVSRSADLAVADELG
FT                   RERERYKLPYGATVTVNEGDEVSGGQVVATWDPHTHPIIAEVEGKVQFGDMEEGITVNH
FT                   QTDELTGLTNIEMLSSQNRPSAGKDMRPVIRVLDSKGKPIVMPNTDMPAQYFLPGGALC
FT                   GLKDGANIGVGDVIARIPQESSKTRDITGGLPRVADLFEARNPKEAAILAEKTGTVSFG
FT                   KETKGKVRLVITPDNSDDNYEELIPKWRQLNVFEGERVEKGEVVSDGPLNPHDILRLKG
FT                   ESELARYIVNEVQEVYRLQGVKINDKHIETIIRQMLRKVEILEVGESHFIKGEQAEYAR
FT                   VMEEIDRLKAEDKMLPQYQRLLLGITKASLATESFISAASFQETTRVLTEAAVTGKEDD
FT                   LRGLKENVVVGRLIPAGTGYAYHMERRRQRADARGPEAPTMDEVEAALSEALSSSGE"
     MKDLLNLLKS QGQVTEFDKI RIALAPPDLI RSWSFGEVKK PETINYRTFK PERDGLFCAR        60
     IFGPIKDYEC LCGKYKRLKH RGVICEKCGV EVTLSKVRRE RMGHIELASP TAHIWFLKSL       120
     PSRIGLMLDM TLRDIERVLY FESFVVTEPG MTTLERGQLL TDEEYFDAME EFGDEFEAKM       180
     GAEAVQQLLM ELDLVEEIKI LREEVESTNS DTKLKKLSKR LKLMEAFKDS GNAPEWMVLT       240
     VLPVLPPDLR PLVPLDGGRF ATSDLNDLYR RVINRNNRLK RLLDLSAPDI IVRNEKRMLQ       300
     ESVDALLDNG RRGRAITGSN KRPLKSLADM IKGKQGRFRQ NLLGKRVDYS GRSVIVVGPT       360
     LKLHECGLPK KMALELFKPF IFAKLEGRGL ATTIKAAKKM VERETAEVWD ILAEVIREHP       420
     VMLNRAPTLH RLGIQAFEPV LIEGKAIQLH PLVCAAFNAD FDGDQMAVHV PLTLEAQLEA       480
     RALMMSTNNI LSPANGEPII GPTQDVVLGL YYISRDRVNA QGEGHVFADT KEVMRALGNK       540
     QVHIHARVKV RVHEVVKDLE GNVEERTFIA DTTPGRCKLW DIVPAGLGFD MVNQNMTKKA       600
     ISKLLNTCYR ILGTKETCIF ADQLMYLGFR EATLSGSSIG VEDMVIPDAK YTMIDAAEEE       660
     VREIEEQFAS GLVTRGERYN KVVDIWARTN DQIAKAMMEN LRVEVVKNRD GKDEEQGSFN       720
     SIFMMADSGA RGSAAQIRQL AGMRGLMAKP DGSIIETPIT SNFREGLNVL QYFISTHGAR       780
     KGLADTALKT ANSGYLTRRL VDVAQDLVVN HIDCGTEEGL LMTPLIEGGD VVEPLRERVL       840
     GRVVARDVMN PLNQDEVAVE AGTLLDEVWV AQLETMGVDE VLVRSPITCA TRWGVCATCY       900
     GRDLARGHQV NVGEAVGVIA AQSIGEPGTQ LTMRTFHIGG AASRASAVSS IQIKHGGKVR       960
     FHNAKHVQHK DGLVIVSRSA DLAVADELGR ERERYKLPYG ATVTVNEGDE VSGGQVVATW      1020
     DPHTHPIIAE VEGKVQFGDM EEGITVNHQT DELTGLTNIE MLSSQNRPSA GKDMRPVIRV      1080
     LDSKGKPIVM PNTDMPAQYF LPGGALCGLK DGANIGVGDV IARIPQESSK TRDITGGLPR      1140
     VADLFEARNP KEAAILAEKT GTVSFGKETK GKVRLVITPD NSDDNYEELI PKWRQLNVFE      1200
     GERVEKGEVV SDGPLNPHDI LRLKGESELA RYIVNEVQEV YRLQGVKIND KHIETIIRQM      1260
     LRKVEILEVG ESHFIKGEQA EYARVMEEID RLKAEDKMLP QYQRLLLGIT KASLATESFI      1320
     SAASFQETTR VLTEAAVTGK EDDLRGLKEN VVVGRLIPAG TGYAYHMERR RQRADARGPE      1380
     APTMDEVEAA LSEALSSSGE                                                  1400
//

If you have problems or comments...

PBIL Back to PBIL home page