(data stored in ACNUC7421 zone)

EMBL: AM286690.RPON

AM286690.RPON        Location/Qualifiers
FT   CDS             complement(610856..612346)
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="ABO_0552"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma54 homolog"
FT                   /note="identified by sequencesimilarity; putative InterPro:
FT                   Sigma-54 factor family"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16000"
FT                   /db_xref="GOA:Q0VS48"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS48"
FT                   /protein_id="CAL16000.1"
FT                   /translation="MGTSRILSSMKPTLQLQIGQQLTMTPQLQQAIRLLQLSTLDLRQE
FT                   IQQAVESNPLLELADDFGDDALPEHDEERQDEELDTDRDNALEELIQDEPEVETEWDDV
FT                   YSGQSTSNSAALPDDADEWQQRHAVSGNLQDHLLWQLNLTPMSDVDRIIAITIIESLDD
FT                   RGYITAPLSDIVDMVNAQPDLLTEGDELEHDEVLAVQHRLQQFDPVGVASVNLADCLGV
FT                   QLRQLPADTPLRDEASALLEHLNLLEKHDYTALRRTLQLSEEVLLEALSLLRTLDPAPG
FT                   EQIGEPQVDYAVPDVIVRQHQGRWQVSLNDDVLPRVNLQQQYASIARTTSGEDGQYLRN
FT                   CVQEAKWFIKSLQSRHDTLLKVATRIVDVQQGFFDYGDEAMKPLVLADIADAVEMHEST
FT                   ISRVTNQKYMMTPRGVFELKYFFSSHVGTDGGGECSSTAIRAIIKKLVAAENPRKPLSD
FT                   NKLASLLNEQGINVARRTVAKYREAMRIPSSSARKRLV"
     MGTSRILSSM KPTLQLQIGQ QLTMTPQLQQ AIRLLQLSTL DLRQEIQQAV ESNPLLELAD        60
     DFGDDALPEH DEERQDEELD TDRDNALEEL IQDEPEVETE WDDVYSGQST SNSAALPDDA       120
     DEWQQRHAVS GNLQDHLLWQ LNLTPMSDVD RIIAITIIES LDDRGYITAP LSDIVDMVNA       180
     QPDLLTEGDE LEHDEVLAVQ HRLQQFDPVG VASVNLADCL GVQLRQLPAD TPLRDEASAL       240
     LEHLNLLEKH DYTALRRTLQ LSEEVLLEAL SLLRTLDPAP GEQIGEPQVD YAVPDVIVRQ       300
     HQGRWQVSLN DDVLPRVNLQ QQYASIARTT SGEDGQYLRN CVQEAKWFIK SLQSRHDTLL       360
     KVATRIVDVQ QGFFDYGDEA MKPLVLADIA DAVEMHESTI SRVTNQKYMM TPRGVFELKY       420
     FFSSHVGTDG GGECSSTAIR AIIKKLVAAE NPRKPLSDNK LASLLNEQGI NVARRTVAKY       480
     REAMRIPSSS ARKRLV                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page