(data stored in ACNUC7421 zone)

EMBL: AM286690.RPSC

AM286690.RPSC        Location/Qualifiers
FT   CDS             451911..452603
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="ABO_0403"
FT                   /product="30S ribosomal protein S3"
FT                   /function="Binds the lower part of the 30S subunit head.
FT                   Binds mRNA in the 70S ribosome, positioning it for
FT                   translation."
FT                   /note="(ribosomal protein S3) identified by
FT                   sequencesimilarity; putative InterPro: Ribosomal protein
FT                   S3"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15851"
FT                   /db_xref="GOA:Q0VSJ7"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSJ7"
FT                   /protein_id="CAL15851.1"
FT                   /translation="MGQKVHPVGIRLGIVKEHNSLWYAGPKSYSDCLVTDLQVREYLFK
FT                   RLKSASVSRIKIERPSENVRITIATARPGIVIGKKGEDVERLRRDVAAKMGVPVHINIE
FT                   EVRKPDLDARLVGDNVAGQLERRVMFRRAMKRAVQNAMKSGAEGIRIQLSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYASVRAETTYGTIGVKVWIFRGEVLGGMEQVQEEQKQSK
FT                   GAKKRGRG"
     MGQKVHPVGI RLGIVKEHNS LWYAGPKSYS DCLVTDLQVR EYLFKRLKSA SVSRIKIERP        60
     SENVRITIAT ARPGIVIGKK GEDVERLRRD VAAKMGVPVH INIEEVRKPD LDARLVGDNV       120
     AGQLERRVMF RRAMKRAVQN AMKSGAEGIR IQLSGRLGGA EIARTEWYRE GRVPLHTLRA       180
     DIDYASVRAE TTYGTIGVKV WIFRGEVLGG MEQVQEEQKQ SKGAKKRGRG                  230
//

If you have problems or comments...

PBIL Back to PBIL home page