(data stored in ACNUC7421 zone)

EMBL: AM286690.RPSE

AM286690.RPSE        Location/Qualifiers
FT   CDS             456472..456975
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="ABO_0414"
FT                   /product="30S ribosomal protein S5"
FT                   /function="In E.coli and S.typhimurium has been shown, with
FT                   S4 and S12, to play an important role in translational
FT                   accuracy; many suppressors of streptomycin-dependent
FT                   mutants of protein S12 are found in this protein, some but
FT                   not all of which decrease translational accuracy (ram,
FT                   ribosomal ambiguity mutations)."
FT                   /note="(ribosomal protein S5) identified by
FT                   sequencesimilarity; putative InterPro: Ribosomal protein
FT                   S5"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15862"
FT                   /db_xref="GOA:Q0VSI6"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSI6"
FT                   /protein_id="CAL15862.1"
FT                   /translation="MVMAKVDPNEGLQEKLVQVNRVAKVVKGGRIFGFTALTVVGDGKG
FT                   KVGFGRGKAREVPAAIQKALEAARRNMIQVELNGTTIQHPMKARHGASKVYMQPADEGT
FT                   GVIAGGAMRAVLEVAGVQNVLAKCYGSTNPVNVVRATFNGLKSMASPESVAAKRGKSVD
FT                   EILN"
     MVMAKVDPNE GLQEKLVQVN RVAKVVKGGR IFGFTALTVV GDGKGKVGFG RGKAREVPAA        60
     IQKALEAARR NMIQVELNGT TIQHPMKARH GASKVYMQPA DEGTGVIAGG AMRAVLEVAG       120
     VQNVLAKCYG STNPVNVVRA TFNGLKSMAS PESVAAKRGK SVDEILN                     167
//

If you have problems or comments...

PBIL Back to PBIL home page