(data stored in ACNUC7421 zone)

EMBL: AM286690.RPSG

AM286690.RPSG        Location/Qualifiers
FT   CDS             428147..428617
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="ABO_0381"
FT                   /product="30S ribosomal protein S7"
FT                   /function="One of the primary rRNA binding proteins, it
FT                   binds directly to 16S rRNA where it nucleates assembly of
FT                   the head domain of the 30S subunit. Is located at the
FT                   subunit interface close to the decoding center, where it
FT                   has been shown to contact mRNA. Probably blocks exit of the
FT                   e-site tRNA (by similarity). Protein S7 is also a
FT                   translational repressor protein; it regulates the
FT                   expression of the str operon members to different degrees
FT                   by binding to its mRNA."
FT                   /note="(ribosomal protein S7) identified by sequence
FT                   similarity; putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15829"
FT                   /db_xref="GOA:Q0VSL9"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSL9"
FT                   /protein_id="CAL15829.1"
FT                   /translation="MPRRRVVAKREILPDPKFGSQILAKFMNHVMVSGKKSVSERIVYG
FT                   ALDIITERKGLDSLETFEKALDNIRPAVEVKSRRVGGATYQVPVEVRPSRRTALAMRWL
FT                   VDAARKRGEKSMPARLAGEVMDAAEGKGAAMKKREDVHRMAEANKAFSHFRF"
     MPRRRVVAKR EILPDPKFGS QILAKFMNHV MVSGKKSVSE RIVYGALDII TERKGLDSLE        60
     TFEKALDNIR PAVEVKSRRV GGATYQVPVE VRPSRRTALA MRWLVDAARK RGEKSMPARL       120
     AGEVMDAAEG KGAAMKKRED VHRMAEANKA FSHFRF                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page