(data stored in ACNUC7421 zone)

EMBL: AM286690.RPSI

AM286690.RPSI        Location/Qualifiers
FT   CDS             635704..636099
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="ABO_0577"
FT                   /product="30S ribosomal protein S9"
FT                   /function="Ribosomal protein S9"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: Ribosomal protein S9"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16025"
FT                   /db_xref="GOA:Q0VS23"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS23"
FT                   /protein_id="CAL16025.1"
FT                   /translation="MATVETNYGTGRRKTSSARVFLRPGSGKISVNGRPLDVYFGRKTN
FT                   QMVVRQPLELVEATDKFDVLVTVSGGGNNGQAGAIRHGITRALMEYDGELRGQLRRAGY
FT                   VTRDAREVERKKVGLRKARRRPQFSKR"
     MATVETNYGT GRRKTSSARV FLRPGSGKIS VNGRPLDVYF GRKTNQMVVR QPLELVEATD        60
     KFDVLVTVSG GGNNGQAGAI RHGITRALME YDGELRGQLR RAGYVTRDAR EVERKKVGLR       120
     KARRRPQFSK R                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page