(data stored in ACNUC7421 zone)

EMBL: AM286690.RPSK

AM286690.RPSK        Location/Qualifiers
FT   CDS             459659..460057
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="ABO_0420"
FT                   /product="30S ribosomal protein S11"
FT                   /function="Located on the platform of the 30S subunit, it
FT                   bridges several disparate RNA helices of the 16S rRNA.
FT                   forms part of the shine-dalgarno cleft in the 70S ribosome.
FT                   Subunit: part of the 30S ribosomal subunit. Interacts with
FT                   proteins S7 and S18. Cross-links to if-3."
FT                   /note="(ribosomal protein S11) identified by
FT                   sequencesimilarity; putative InterPro: Ribosomal protein
FT                   S11"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15868"
FT                   /db_xref="GOA:Q0VSI0"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSI0"
FT                   /protein_id="CAL15868.1"
FT                   /translation="MAKSKKDSGARRKKVTRTVADGIAHVHASFNNTIITITDRQGNAL
FT                   SWATSGGAGFRGSRKSTPFAAQVAAENAGNAAKDYGLKNLEVRVKGPGPGRESSIRALN
FT                   GCGYKITHIEDVTPIPHNGCRPPKKRRV"
     MAKSKKDSGA RRKKVTRTVA DGIAHVHASF NNTIITITDR QGNALSWATS GGAGFRGSRK        60
     STPFAAQVAA ENAGNAAKDY GLKNLEVRVK GPGPGRESSI RALNGCGYKI THIEDVTPIP       120
     HNGCRPPKKR RV                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page