(data stored in ACNUC7421 zone)

EMBL: AM286690.RPST

AM286690.RPST        Location/Qualifiers
FT   CDS             complement(495692..495958)
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="ABO_0456"
FT                   /product="30S ribosomal protein S20."
FT                   /function="Binds directly to 16S ribosomal RNA."
FT                   /note="(ribosomal protein S20) identified by
FT                   sequencesimilarity; putative InterPro: Ribosomal protein
FT                   S20"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15904"
FT                   /db_xref="GOA:Q0VSE4"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSE4"
FT                   /protein_id="CAL15904.1"
FT                   /translation="MANSPQARKRARQAENRRQHNAAMRSMVRTYLKKVNAAIASGDQG
FT                   SAQEAYNQAVSVLDKATRKGKFHPNKAARHKSRLNTKIKAMAA"
     MANSPQARKR ARQAENRRQH NAAMRSMVRT YLKKVNAAIA SGDQGSAQEA YNQAVSVLDK        60
     ATRKGKFHPN KAARHKSRLN TKIKAMAA                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page