(data stored in ACNUC7421 zone)

EMBL: AM286690.RUBB

AM286690.RUBB        Location/Qualifiers
FT   CDS             complement(170672..171820)
FT                   /transl_table=11
FT                   /gene="rubB"
FT                   /locus_tag="ABO_0162"
FT                   /product="rubredoxin reductase"
FT                   /function="rubredoxin and rubredoxin reductase (reduces
FT                   rubredoxin + nad(+) = oxidized rubredoxin + nadh)"
FT                   /EC_number="1.18.1.-"
FT                   /note="(NAD(FAD)-dependent dehydrogenases) identified by
FT                   match to TIGR protein family HMMTIGR01508 InterPro:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15610"
FT                   /db_xref="GOA:Q0VTB0"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VTB0"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR01508"
FT                   /protein_id="CAL15610.1"
FT                   /translation="MHPIVIVGTGLAGFNTVKEFRKLDKETPIVMLTADDGRNYSKPML
FT                   SAGFSKGKTADDLCMATPEKVAEQLNVDVRTGVHVAGIDATNKRVLLPDDHLDYSKLVL
FT                   ALGADTWTPPLEGDAVGEVFSVNDLMDYGKFRAAVEGKKTVTILGGGLIGCEFANDLSN
FT                   GGFKVSLVEPMGRCLPLLLPEQASEAVGRGLADLGVQFHFGPLAKAVHHGDNGQLVTEL
FT                   SDGSQLESDVVLSAIGLRPRISLAKEAGLDTNRGILTDKSLRTSAEHIYALGDCAEVQG
FT                   HVLPYVLPLMASARALAKTLAGETTEVSYGVMPVTIKTPACPVVVCPAAEGSEGAWEVE
FT                   AEGNTVQALFRSKDGSLLGYALTGEAVKEKMKLNKELPAIMP"
     MHPIVIVGTG LAGFNTVKEF RKLDKETPIV MLTADDGRNY SKPMLSAGFS KGKTADDLCM        60
     ATPEKVAEQL NVDVRTGVHV AGIDATNKRV LLPDDHLDYS KLVLALGADT WTPPLEGDAV       120
     GEVFSVNDLM DYGKFRAAVE GKKTVTILGG GLIGCEFAND LSNGGFKVSL VEPMGRCLPL       180
     LLPEQASEAV GRGLADLGVQ FHFGPLAKAV HHGDNGQLVT ELSDGSQLES DVVLSAIGLR       240
     PRISLAKEAG LDTNRGILTD KSLRTSAEHI YALGDCAEVQ GHVLPYVLPL MASARALAKT       300
     LAGETTEVSY GVMPVTIKTP ACPVVVCPAA EGSEGAWEVE AEGNTVQALF RSKDGSLLGY       360
     ALTGEAVKEK MKLNKELPAI MP                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page