(data stored in ACNUC7421 zone)

EMBL: AM286690.SECD

AM286690.SECD        Location/Qualifiers
FT   CDS             551947..553860
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="ABO_0503"
FT                   /product="Preprotein translocase SecD subunit"
FT                   /function="Involved in protein export. Subunit: part of the
FT                   prokaryotic protein translocation apparatus which comprise
FT                   secA, secB, secD, secE, secF, secG and secY."
FT                   /note="(protein-export membrane protein SecD) identified by
FT                   sequencesimilarity; putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15951"
FT                   /db_xref="GOA:Q0VS97"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS97"
FT                   /protein_id="CAL15951.1"
FT                   /translation="MIKKSALLERTMTRYPRWKFFLLMAALVVCSLYALPNLYPDAPAI
FT                   QISHSEAGGEVSAVARQRVLSALDAAGLAHGDGEVVGSSLLVRMNDTEAQLRAKDIAAS
FT                   TLGDNYVVALNLAATTPQWLRDIGASPMNLGLDLRGGVHFLLQVDMDSVVKSRMEAWEG
FT                   TAKLTLRDAGVRYREVSVDGTTLIATFGDQVAADAARAPLRQALDKLAMQPAGDSPRIV
FT                   MTLNETALKEMQDYAVDQNRTALNKRVNELGVAEAVVQRQGADRIVVQLPGIQDAATAR
FT                   RILGRTATLEFRLVDNSVSSARLRSGMAPPGLEFFPFKGQEGRIVALNKSSIATGDQVI
FT                   DAKMGFDQQNGQPEVNVTLDSDGARRMQRVTGKNVGNPMGVLFIETKTDVKKVIDEDGN
FT                   SVEQMTSSTDKYVINVATIQSTLGSRFRITGLDNPAEASELALLLRAGSLAAPVSIVEE
FT                   RTVGPSLGAENIEAGLKSMALGLALVLAFMVLWYKVFGLIANVALLGNLVIIVGVMSLI
FT                   PGATMTLPGIAGIVLTVGMAVDANVLIFERIREDLRRGLSPRQAIEEGYARAFTTILDA
FT                   NITTLIVAVILFAAGTGSVQGFAVTLFIGILTSMFTAIIGTRAMAEMIYGRGARAPSKL
FT                   SI"
     MIKKSALLER TMTRYPRWKF FLLMAALVVC SLYALPNLYP DAPAIQISHS EAGGEVSAVA        60
     RQRVLSALDA AGLAHGDGEV VGSSLLVRMN DTEAQLRAKD IAASTLGDNY VVALNLAATT       120
     PQWLRDIGAS PMNLGLDLRG GVHFLLQVDM DSVVKSRMEA WEGTAKLTLR DAGVRYREVS       180
     VDGTTLIATF GDQVAADAAR APLRQALDKL AMQPAGDSPR IVMTLNETAL KEMQDYAVDQ       240
     NRTALNKRVN ELGVAEAVVQ RQGADRIVVQ LPGIQDAATA RRILGRTATL EFRLVDNSVS       300
     SARLRSGMAP PGLEFFPFKG QEGRIVALNK SSIATGDQVI DAKMGFDQQN GQPEVNVTLD       360
     SDGARRMQRV TGKNVGNPMG VLFIETKTDV KKVIDEDGNS VEQMTSSTDK YVINVATIQS       420
     TLGSRFRITG LDNPAEASEL ALLLRAGSLA APVSIVEERT VGPSLGAENI EAGLKSMALG       480
     LALVLAFMVL WYKVFGLIAN VALLGNLVII VGVMSLIPGA TMTLPGIAGI VLTVGMAVDA       540
     NVLIFERIRE DLRRGLSPRQ AIEEGYARAF TTILDANITT LIVAVILFAA GTGSVQGFAV       600
     TLFIGILTSM FTAIIGTRAM AEMIYGRGAR APSKLSI                                637
//

If you have problems or comments...

PBIL Back to PBIL home page