(data stored in ACNUC7421 zone)

EMBL: AM286690.SECF

AM286690.SECF        Location/Qualifiers
FT   CDS             553868..554791
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="ABO_0504"
FT                   /product="Preprotein translocase SecF subunit"
FT                   /function="Involved in protein export. subunit part of the
FT                   prokaryotic protein translocation apparatus which comprise
FT                   secA, secB, secD, secE, secF, secG and secY."
FT                   /note="(protein-export membrane protein SecF) identified by
FT                   match to PFAM protein family HMMPF03631 InterPro:
FT                   SecD/SecF/SecDF export membrane proteins"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15952"
FT                   /db_xref="GOA:Q0VS96"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS96"
FT                   /inference="protein motif:HMMPFAM:HMMPF03631"
FT                   /protein_id="CAL15952.1"
FT                   /translation="MSKAPMNINFMAARKPLGVLSLALVIISVVLLLTRGLNLGLDFTG
FT                   GTTVVVKSPTDVELSQARDDLTEAGFGDAVVQHYGSPKEVNIRVAPKDDADADKVGQNV
FT                   FNVLKEHNADLELLKVEFVGPQVGDELRDESGTAMLLALGLMMLYVWFRFSNKFGVATV
FT                   LALFHDVIIVLGLFALIQWPFDLTVLAAVLALIGYSLNDSIVVADRIREDFRSTRETDP
FT                   VAIINGAVNQTFTRTINTSVTTLLVLVALYFFGGEVMRAFSEALLVGVLVGTYSSIYVV
FT                   SNILFMMKVSKEDFMIPEPEEVDEMP"
     MSKAPMNINF MAARKPLGVL SLALVIISVV LLLTRGLNLG LDFTGGTTVV VKSPTDVELS        60
     QARDDLTEAG FGDAVVQHYG SPKEVNIRVA PKDDADADKV GQNVFNVLKE HNADLELLKV       120
     EFVGPQVGDE LRDESGTAML LALGLMMLYV WFRFSNKFGV ATVLALFHDV IIVLGLFALI       180
     QWPFDLTVLA AVLALIGYSL NDSIVVADRI REDFRSTRET DPVAIINGAV NQTFTRTINT       240
     SVTTLLVLVA LYFFGGEVMR AFSEALLVGV LVGTYSSIYV VSNILFMMKV SKEDFMIPEP       300
     EEVDEMP                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page