(data stored in ACNUC7421 zone)

EMBL: AM286690.SECY

AM286690.SECY        Location/Qualifiers
FT   CDS             457632..459014
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="ABO_0417"
FT                   /product="Preprotein translocase SecY subunit"
FT                   /function="Involved in protein export. Interacts with secA
FT                   and secE to allow the translocation of proteins across the
FT                   plasma membrane, by forming part of a channel. subunit one
FT                   of seven secretory proteins (seca-f & secy) that comprise
FT                   the prokaryotic protein translocation apparatus."
FT                   /note="(Sec-dependent secretion protein SecY) identified by
FT                   sequence similarity;putative InterPro: SecY protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15865"
FT                   /db_xref="GOA:Q0VSI3"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSI3"
FT                   /protein_id="CAL15865.1"
FT                   /translation="MAKNRAQTLNGGAPKADGNAMRELWRRIGFLLGALVVFRVGAHIP
FT                   VPGMNPEALQQMFNNNRDTILGLFNMFSGGSLERMSIFALGIMPYITASIVIQLMTAVV
FT                   PTLEQLRKEGEQGRRKITQYTRYLTVVLGAIQSFGMVAGLNSQGITLLPETASTMQLAS
FT                   FYFVAVSTLVTGTVFLMWLGEQITERGIGNGISMLIFASIVSGLPGAVAQTFESARTGD
FT                   LSLIMMLFVFLVAMAVIFGVVYVERGQRRITVNYARRQQGRRVYAAQQSHLPLKVNMAG
FT                   VIPAIFASSILLFPASLTQWFSDSNPDSWWGQALRNVSEALLPGTPLYILLFTLAIVFF
FT                   CYFYTALVFNPKDVADNLKKSGAYIPGIRPGEQSARYIDTVMGRLTLIGAVYMTLVCLL
FT                   PLGLQAVANVPFYLGGTSLLIVVVVVMDFWSQVNSHLTSTQYEKLMKKSNLKGYGGTGL
FT                   VR"
     MAKNRAQTLN GGAPKADGNA MRELWRRIGF LLGALVVFRV GAHIPVPGMN PEALQQMFNN        60
     NRDTILGLFN MFSGGSLERM SIFALGIMPY ITASIVIQLM TAVVPTLEQL RKEGEQGRRK       120
     ITQYTRYLTV VLGAIQSFGM VAGLNSQGIT LLPETASTMQ LASFYFVAVS TLVTGTVFLM       180
     WLGEQITERG IGNGISMLIF ASIVSGLPGA VAQTFESART GDLSLIMMLF VFLVAMAVIF       240
     GVVYVERGQR RITVNYARRQ QGRRVYAAQQ SHLPLKVNMA GVIPAIFASS ILLFPASLTQ       300
     WFSDSNPDSW WGQALRNVSE ALLPGTPLYI LLFTLAIVFF CYFYTALVFN PKDVADNLKK       360
     SGAYIPGIRP GEQSARYIDT VMGRLTLIGA VYMTLVCLLP LGLQAVANVP FYLGGTSLLI       420
     VVVVVMDFWS QVNSHLTSTQ YEKLMKKSNL KGYGGTGLVR                             460
//

If you have problems or comments...

PBIL Back to PBIL home page