(data stored in ACNUC7421 zone)

EMBL: AM286690.SFSA

AM286690.SFSA        Location/Qualifiers
FT   CDS             383539..384258
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="ABO_0347"
FT                   /product="sugar fermentation stimulation protein, putative"
FT                   /function="The sugar fermentation stimulation protein is a
FT                   probable regulatory factor involved in maltose metabolism"
FT                   /note="(sugar fermentation stimulation protein)"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15795"
FT                   /db_xref="GOA:Q0VSQ3"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSQ3"
FT                   /protein_id="CAL15795.1"
FT                   /translation="MKFDPPLETVTLLRRYKRFMADVVRADGSEITVHCPNTGSMKNCV
FT                   LGGPQQALISDSGNPKRKYRHTLEALQVAHGHWAGVNTARPNALVEEAVRAGQFPMLDS
FT                   TSGVEREVKYGDSRFDLALGERADPHTFIEVKNVTLGPGPDDKDDGVIAFPDSVTERGQ
FT                   KHLQTLMDVVASGKRAVLFFCVQHSGATAARPADEIDARYGQLLREAIENGVEVLAWKS
FT                   EVSAQCFRLKEPLPLDL"
     MKFDPPLETV TLLRRYKRFM ADVVRADGSE ITVHCPNTGS MKNCVLGGPQ QALISDSGNP        60
     KRKYRHTLEA LQVAHGHWAG VNTARPNALV EEAVRAGQFP MLDSTSGVER EVKYGDSRFD       120
     LALGERADPH TFIEVKNVTL GPGPDDKDDG VIAFPDSVTE RGQKHLQTLM DVVASGKRAV       180
     LFFCVQHSGA TAARPADEID ARYGQLLREA IENGVEVLAW KSEVSAQCFR LKEPLPLDL        239
//

If you have problems or comments...

PBIL Back to PBIL home page