(data stored in ACNUC7421 zone)

EMBL: AM286690.SMPB

AM286690.SMPB        Location/Qualifiers
FT   CDS             complement(333505..334005)
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="ABO_0305"
FT                   /product="ssrA-binding protein"
FT                   /function="binds specifically to the ssra RNA (tmRNA) and
FT                   is required for stable association of ssra with ribosomes"
FT                   /note="identified by sequencesimilarity; putative InterPro:
FT                   SmpB protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15753"
FT                   /db_xref="GOA:Q0VSU5"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSU5"
FT                   /protein_id="CAL15753.1"
FT                   /translation="MLYNCRPMGKANKKAKAPSATIAQNRKARHEYHLEEHFEAGLVLE
FT                   GWEVKSLRAGKGNLTEAYVLLKNGEAFLFGARFEPLNTASTHVNPDPTRTRKLLLHRRE
FT                   LGRVFGGVQKDGFTCVPVSLYWKKGFAKCDIALAKGKQKFDKRATEKERDWNRQKQRVL
FT                   RQR"
     MLYNCRPMGK ANKKAKAPSA TIAQNRKARH EYHLEEHFEA GLVLEGWEVK SLRAGKGNLT        60
     EAYVLLKNGE AFLFGARFEP LNTASTHVNP DPTRTRKLLL HRRELGRVFG GVQKDGFTCV       120
     PVSLYWKKGF AKCDIALAKG KQKFDKRATE KERDWNRQKQ RVLRQR                      166
//

If you have problems or comments...

PBIL Back to PBIL home page