(data stored in ACNUC7421 zone)

EMBL: AM286690.SSPB

AM286690.SSPB        Location/Qualifiers
FT   CDS             639573..639980
FT                   /transl_table=11
FT                   /gene="sspB"
FT                   /locus_tag="ABO_0582"
FT                   /product="stringent starvation protein B"
FT                   /function="stringent starvation protein B (SspB), is
FT                   thought to enhance the specificity of degradation of
FT                   tmRNA-tagged proteins by the ClpXP protease. The tmRNA tag,
FT                   also known as ssrA, is an 11-aa peptide added to the C
FT                   terminus of proteins stalled during translation, targets
FT                   proteins for degradation by ClpXP and ClpAP. SspB a
FT                   cytoplasmic protein that specifically binds to residues 1-4
FT                   and 7 of the tag."
FT                   /function="Binding of SspB enhances degradation of tagged
FT                   proteins by ClpX, and masks sequence elements important for
FT                   ClpA interactions, inhibiting degradation by ClpA [1].
FT                   However, more recent work has cast doubt on the importance
FT                   of SspB in wild-type cells [2]. SspB is encoded in an
FT                   operon whose synthesis is stimulated by carbon, amino acid,
FT                   and phosphate starvation. SspB may play a special role
FT                   during nutrient stress, for example by ensuring rapid
FT                   degradation of the products of stalled translation, without
FT                   causing a global increase in degradation of all ClpXP
FT                   substrates"
FT                   /note="identified by sequence similarity; putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16030"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS18"
FT                   /protein_id="CAL16030.1"
FT                   /translation="MSEMTSNRPYLIRAIHEWICDNGLTTHLAVNAGFPGVEVPQDFVQ
FT                   DGQIVLNIAPRAVTQFVADNDEIAFSARFGGMPMTIRVPINAVVAIFARENGQGMAFDP
FT                   VDPPEPPTPTTPELEKKDQGRGKVSHLKVVK"
     MSEMTSNRPY LIRAIHEWIC DNGLTTHLAV NAGFPGVEVP QDFVQDGQIV LNIAPRAVTQ        60
     FVADNDEIAF SARFGGMPMT IRVPINAVVA IFARENGQGM AFDPVDPPEP PTPTTPELEK       120
     KDQGRGKVSH LKVVK                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page