(data stored in ACNUC7421 zone)

EMBL: AM286690.SUN;-RSMB

AM286690.SUN;-RSMB   Location/Qualifiers
FT   CDS             complement(139859..141202)
FT                   /transl_table=11
FT                   /gene="sun; rsmB"
FT                   /locus_tag="ABO_0129"
FT                   /product="tRNA and rRNA cytosine-C5-methylase, putative"
FT                   /function="tRNA and rRNA cytosine"
FT                   /EC_number="2.1.1.37"
FT                   /note="(sun) (sun protein, putative) identified by match to
FT                   PFAM protein family HMMPF01189 InterPro: Sun protein"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15577"
FT                   /db_xref="GOA:Q0VTE3"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTE3"
FT                   /inference="protein motif:HMMPFAM:HMMPF01189"
FT                   /protein_id="CAL15577.1"
FT                   /translation="MPLSMNLVTTVATPDPRLSAVRALNRVLPGKGDGESLREVLRDFP
FT                   LQGSDGGQMRDICFGVCRHLRPLNHWLNQQLSKPLKGSAQPVRLALLAGLYELWFSNRP
FT                   AHAIVNAYPQLCRKLKAPWAAGLSNAVLRKASQITLEQAVADAPINIQLSLPDWLFKRW
FT                   EKDWPNNADAMARANLQTPPFTLRVNRQQQQRADAIAALGEGARAGYIAPYSIYLQPAR
FT                   PVLQLPGFEQGALSVQDEAAQLPAELLQAPAKGRILDACAAPGGKTGQLREKFPAADLS
FT                   ALELEGKRLARIRENLARLGTDVTLLQGDASDPKTWWDGTPFDAILLDAPCSATGILRR
FT                   QPDVKWHRKASDIGVLVDLQARMLDALWPLLKPGGMLVYATCSVLRDENDHQVRNFLQR
FT                   QPQARDVTPRPEGATMVDAGWQLFPEQHGPDGFYLACLRKESGAQLSS"
     MPLSMNLVTT VATPDPRLSA VRALNRVLPG KGDGESLREV LRDFPLQGSD GGQMRDICFG        60
     VCRHLRPLNH WLNQQLSKPL KGSAQPVRLA LLAGLYELWF SNRPAHAIVN AYPQLCRKLK       120
     APWAAGLSNA VLRKASQITL EQAVADAPIN IQLSLPDWLF KRWEKDWPNN ADAMARANLQ       180
     TPPFTLRVNR QQQQRADAIA ALGEGARAGY IAPYSIYLQP ARPVLQLPGF EQGALSVQDE       240
     AAQLPAELLQ APAKGRILDA CAAPGGKTGQ LREKFPAADL SALELEGKRL ARIRENLARL       300
     GTDVTLLQGD ASDPKTWWDG TPFDAILLDA PCSATGILRR QPDVKWHRKA SDIGVLVDLQ       360
     ARMLDALWPL LKPGGMLVYA TCSVLRDEND HQVRNFLQRQ PQARDVTPRP EGATMVDAGW       420
     QLFPEQHGPD GFYLACLRKE SGAQLSS                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page