(data stored in ACNUC7421 zone)

EMBL: AM286690.TRUB

AM286690.TRUB        Location/Qualifiers
FT   CDS             363476..364402
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="ABO_0331"
FT                   /product="pseudouridylate synthase"
FT                   /function="formation of pseudouridine at position 55 in the
FT                   psi gc loop of transfer rnas (uracil + d-ribose 5-phosphate
FT                   = pseudouridine 5'-phosphate + h(2)o)"
FT                   /EC_number="4.2.1.70"
FT                   /note="ABC efflux transporter permease/ATP-bindingprotein
FT                   putative identified by sequence similarity; putative
FT                   InterPro: tRNA pseudouridine synthase B"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15779"
FT                   /db_xref="GOA:Q0VSR9"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSR9"
FT                   /protein_id="CAL15779.1"
FT                   /translation="MAKRRPRGRDLNGILLLDKSSGVSSNGALQMAKKMFAAAKAGHTG
FT                   SLDPLATGMLPICFGEATKFSQFLLESDKSYRVTAKLGVTTETGDADGNVVNTTEVSAS
FT                   AAQIEAALLSFKGDIEQIPSMYSAIKHEGVPLYKLAREGITVERKPRPVTIYDLRILRI
FT                   DGDELEFEVDCSKGTYVRSLVEDTGALLGCGGHVTALHRLSAGPYPAERMLTLEQLGKI
FT                   KETGGFEAIDELLLPLSTSVADWPRVELGDNAAYYLQQGQPVMASDRPLDGWVSVYQAS
FT                   SGEFLGVGEILEDGRIAPRRLVAGGAS"
     MAKRRPRGRD LNGILLLDKS SGVSSNGALQ MAKKMFAAAK AGHTGSLDPL ATGMLPICFG        60
     EATKFSQFLL ESDKSYRVTA KLGVTTETGD ADGNVVNTTE VSASAAQIEA ALLSFKGDIE       120
     QIPSMYSAIK HEGVPLYKLA REGITVERKP RPVTIYDLRI LRIDGDELEF EVDCSKGTYV       180
     RSLVEDTGAL LGCGGHVTAL HRLSAGPYPA ERMLTLEQLG KIKETGGFEA IDELLLPLST       240
     SVADWPRVEL GDNAAYYLQQ GQPVMASDRP LDGWVSVYQA SSGEFLGVGE ILEDGRIAPR       300
     RLVAGGAS                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page