(data stored in ACNUC7421 zone)

EMBL: AM286690.TTK

AM286690.TTK         Location/Qualifiers
FT   CDS             complement(226609..227193)
FT                   /transl_table=11
FT                   /gene="ttk"
FT                   /locus_tag="ABO_0209"
FT                   /product="ttk protein, putative"
FT                   /function="regulation of transcription"
FT                   /note="transcriptional regulator TetR family identified by
FT                   sequencesimilarity; putative InterPro: Bacterial regulatory
FT                   proteins TetR family"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15657"
FT                   /db_xref="GOA:Q0VT63"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT63"
FT                   /protein_id="CAL15657.1"
FT                   /translation="MTDKKPSRKEQILQSLAHMLEAAPGGRITTAGLAREVGVSEAALY
FT                   RHFPSKAKMFEGLISFIEEAIFSRINRIVEDGQASDQVEQILTLLLAFTERNPGITRLL
FT                   TGDALTGENARLHLRIQQFYDRVESQVKKVLRDAELKEGLRTQATPTVTANLLLAVAEG
FT                   RIAQFVRSGFKIKPGQDWPAQWALLQPTLFR"
     MTDKKPSRKE QILQSLAHML EAAPGGRITT AGLAREVGVS EAALYRHFPS KAKMFEGLIS        60
     FIEEAIFSRI NRIVEDGQAS DQVEQILTLL LAFTERNPGI TRLLTGDALT GENARLHLRI       120
     QQFYDRVESQ VKKVLRDAEL KEGLRTQATP TVTANLLLAV AEGRIAQFVR SGFKIKPGQD       180
     WPAQWALLQP TLFR                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page