(data stored in ACNUC7421 zone)

EMBL: AM286690.UVRA

AM286690.UVRA        Location/Qualifiers
FT   CDS             complement(464651..467473)
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="ABO_0427"
FT                   /product="excinuclease ABC, A subunit"
FT                   /function="the uvrabc repair system catalyzes the
FT                   recognition and processing of DNA lesions. uvra is an
FT                   ATPase and a DNA-binding protein. a damage recognition
FT                   complex composed of 2 uvra and 2 uvrb subunits scans DNA
FT                   for abnormalities. when the presence of a lesion has been
FT                   verified by uvrb, the uvra molecules dissociate."
FT                   /note="identified by sequence similarity; putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15875"
FT                   /db_xref="GOA:Q0VSH3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSH3"
FT                   /protein_id="CAL15875.1"
FT                   /translation="MDTIVVRGARTHNLKNVDLDIPRDKLVVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSTYARQFLSMMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   YDYLRLLFARVGEPRCPEHGAPLAAQTISQMVDQVLAMEEGSKLMLLAPVIREKKGEHA
FT                   HLFEELRAQGFIRARIDGRIYDMDDTPDLDKNKKHTIEVVVDRFKVRSDLQNRLAESFE
FT                   TALNLADNIAVIAPMEGEGEETTFSAKFACPTCGYSIPELEPRLFSFNNPAGACPSCDG
FT                   LGIKQFFDEGKVINSDELSLSEGAIRGWDRRNVYYFQMLNSLSQSIGFDMDTAFKDLPK
FT                   EIRSKVLHGTGKESIEFRYLNDRGDIIKRNHPFEGIIPNMERRYRETESDAVREDLLGY
FT                   MSTSSCPSCNGSRLREAARHVFIEQTTLPEVVRLPVGKAHAYFSNLKLPGSRGEIAGKI
FT                   LKEISDRLQFLVNVGLEYLTLERSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSIG
FT                   LHQRDNERLLNTLTRLRDLGNSVLVVEHDEDAIRLADHVIDIGPGAGVHGGKVIAQGSA
FT                   QDVADNPDSLTGDYLSGRKKIAVPTQHRPHNDDRWLTLLGATGNNLKGQPLNIPVGLLT
FT                   CITGVSGSGKSTLINGTLYPLAATKLNKATTLTPSPHESIEGLEHFDKVVDIDQSPIGR
FT                   TPRSNPATYTGIFTPVRELFAGTQEARARGYKPGRFSFNVKGGRCEACQGDGVIKVEMH
FT                   FLPDIYVPCEVCNGQRYNRETLEITYKGKNIFEVLDLTIEDAREFFDAVPSLARKLQTL
FT                   IDVGLSYVKLGQAATTLSGGEAQRVKLAKELSRRDTGNTLYILDEPTTGLHFHDIQLLL
FT                   DVLNRLADHGNSVVVIEHNLDVIKTADWIVDLGPEGGDGGGEIIAEGTPEEVAKVKGSH
FT                   TGRFLKPMLK"
     MDTIVVRGAR THNLKNVDLD IPRDKLVVIT GLSGSGKSSL AFDTLYAEGQ RRYVESLSTY        60
     ARQFLSMMEK PDVDHIEGLS PAISIEQKST SHNPRSTVGT ITEIYDYLRL LFARVGEPRC       120
     PEHGAPLAAQ TISQMVDQVL AMEEGSKLML LAPVIREKKG EHAHLFEELR AQGFIRARID       180
     GRIYDMDDTP DLDKNKKHTI EVVVDRFKVR SDLQNRLAES FETALNLADN IAVIAPMEGE       240
     GEETTFSAKF ACPTCGYSIP ELEPRLFSFN NPAGACPSCD GLGIKQFFDE GKVINSDELS       300
     LSEGAIRGWD RRNVYYFQML NSLSQSIGFD MDTAFKDLPK EIRSKVLHGT GKESIEFRYL       360
     NDRGDIIKRN HPFEGIIPNM ERRYRETESD AVREDLLGYM STSSCPSCNG SRLREAARHV       420
     FIEQTTLPEV VRLPVGKAHA YFSNLKLPGS RGEIAGKILK EISDRLQFLV NVGLEYLTLE       480
     RSAETLSGGE AQRIRLASQI GAGLVGVMYV LDEPSIGLHQ RDNERLLNTL TRLRDLGNSV       540
     LVVEHDEDAI RLADHVIDIG PGAGVHGGKV IAQGSAQDVA DNPDSLTGDY LSGRKKIAVP       600
     TQHRPHNDDR WLTLLGATGN NLKGQPLNIP VGLLTCITGV SGSGKSTLIN GTLYPLAATK       660
     LNKATTLTPS PHESIEGLEH FDKVVDIDQS PIGRTPRSNP ATYTGIFTPV RELFAGTQEA       720
     RARGYKPGRF SFNVKGGRCE ACQGDGVIKV EMHFLPDIYV PCEVCNGQRY NRETLEITYK       780
     GKNIFEVLDL TIEDAREFFD AVPSLARKLQ TLIDVGLSYV KLGQAATTLS GGEAQRVKLA       840
     KELSRRDTGN TLYILDEPTT GLHFHDIQLL LDVLNRLADH GNSVVVIEHN LDVIKTADWI       900
     VDLGPEGGDG GGEIIAEGTP EEVAKVKGSH TGRFLKPMLK                             940
//

If you have problems or comments...

PBIL Back to PBIL home page