(data stored in ACNUC7421 zone)

EMBL: AM286690.YAJC

AM286690.YAJC        Location/Qualifiers
FT   CDS             551433..551795
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="ABO_0502"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF02699 InterPro: Domain of unknown function DUF219"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15950"
FT                   /db_xref="GOA:Q0VS98"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS98"
FT                   /inference="protein motif:HMMPFAM:HMMPF02699"
FT                   /protein_id="CAL15950.1"
FT                   /translation="MNIAMRSLLALMAAAMVSPAFAAPAAPAGPGGVELIMLVVMMVVF
FT                   YFFLIRPQQKRAKEHKNLVQSLSKGDEVVTSGGILGKVAKVTDDFVVVEISNNLEIKLQ
FT                   KSSVQATLPKGTIKSI"
     MNIAMRSLLA LMAAAMVSPA FAAPAAPAGP GGVELIMLVV MMVVFYFFLI RPQQKRAKEH        60
     KNLVQSLSKG DEVVTSGGIL GKVAKVTDDF VVVEISNNLE IKLQKSSVQA TLPKGTIKSI       120
//

If you have problems or comments...

PBIL Back to PBIL home page