(data stored in ACNUC7421 zone)

EMBL: AM286690.YBAK

AM286690.YBAK        Location/Qualifiers
FT   CDS             389925..390392
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="ABO_0353"
FT                   /product="protein ybaK"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="conserved hypothetical protein TIGR00011 identified
FT                   by sequence similarity; putative"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15801"
FT                   /db_xref="GOA:Q0VSP7"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSP7"
FT                   /protein_id="CAL15801.1"
FT                   /translation="MTPAVNAAKRAKVAFGLHSYEHDPKAPSYGLEAAQALNLPVERVF
FT                   KTLLALVDGAPVVAMVPVAHQLDLKCLARAHGGKKAQMCPADKAQRLTGYVLGGISPLG
FT                   QKKRLPLYLDSSAAEQAEIFMSAGRRGLEIAMAPRDLLALTGGKMVALVRD"
     MTPAVNAAKR AKVAFGLHSY EHDPKAPSYG LEAAQALNLP VERVFKTLLA LVDGAPVVAM        60
     VPVAHQLDLK CLARAHGGKK AQMCPADKAQ RLTGYVLGGI SPLGQKKRLP LYLDSSAAEQ       120
     AEIFMSAGRR GLEIAMAPRD LLALTGGKMV ALVRD                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page