(data stored in ACNUC7421 zone)

EMBL: AM286690.YGIX

AM286690.YGIX        Location/Qualifiers
FT   CDS             complement(33315..33977)
FT                   /transl_table=11
FT                   /gene="ygiX"
FT                   /locus_tag="ABO_0031"
FT                   /product="transcriptional regulatory protein qseb"
FT                   /function="DNA binding"
FT                   /note="probable 2-component transcription regulator
FT                   identified by match to TIGR protein family HMMTIGR01387
FT                   InterPro: Response regulator receiver domain"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15480"
FT                   /db_xref="GOA:Q0VTM8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTM8"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR01387"
FT                   /protein_id="CAL15480.1"
FT                   /translation="MHILLIEDDALLGDGIQAGLQAMGFTVAWVTLARDGLAAWKSVDF
FT                   DALVLDLGLPDQEGSEALCQWREAGLTVPVLILTARDAVQDRIDGLQRGADDYLIKPFD
FT                   LGELAARLQALLRRTRGQARPFIEHGRLRVDPFRQQVWLADKEVELQRREMALLLALLQ
FT                   SQGRLLTADQLADRVYGWMDGVESNALTVHIHNLRRKLDSRIVETVRGGGYRLGAPL"
     MHILLIEDDA LLGDGIQAGL QAMGFTVAWV TLARDGLAAW KSVDFDALVL DLGLPDQEGS        60
     EALCQWREAG LTVPVLILTA RDAVQDRIDG LQRGADDYLI KPFDLGELAA RLQALLRRTR       120
     GQARPFIEHG RLRVDPFRQQ VWLADKEVEL QRREMALLLA LLQSQGRLLT ADQLADRVYG       180
     WMDGVESNAL TVHIHNLRRK LDSRIVETVR GGGYRLGAPL                             220
//

If you have problems or comments...

PBIL Back to PBIL home page