(data stored in ACNUC7421 zone)

EMBL: AM286690.ZNUB

AM286690.ZNUB        Location/Qualifiers
FT   CDS             165728..166576
FT                   /transl_table=11
FT                   /gene="znuB"
FT                   /locus_tag="ABO_0157"
FT                   /product="zinc ABC transporter permease protein"
FT                   /note="(zinc ABC transporter permease protein ZnuB)
FT                   identified by match to PFAM protein family HMMPF01032
FT                   InterPro: ABC 3 transport family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15605"
FT                   /db_xref="GOA:Q0VTB5"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTB5"
FT                   /inference="protein motif:HMMPFAM:HMMPF01032"
FT                   /protein_id="CAL15605.1"
FT                   /translation="MITTMICTAMPRIPTITTGPAIMIELLLPPLLAGLAVALVSGPMG
FT                   AFVVWRRMAFFGDTLAHGALLGAALALALDISLYVAVVAVCLGLAAALSGLQRQRQLAG
FT                   DTLLGIVAHTTLALGVIAISLQTGIQVDLFAYLFGDLLAVGWQDVTGLWVGAMVILMLM
FT                   LWQWRALLSITVNEELAQVEGIAVQRTRLLLMLLLALLIAGAIRTVGVLLITSLLVIPA
FT                   ASARRLTHTPAQMAAVASVLGTLSVLVGLAVSWYANTPVGPSIVVAASSLFVLTLLRRG
FT                   S"
     MITTMICTAM PRIPTITTGP AIMIELLLPP LLAGLAVALV SGPMGAFVVW RRMAFFGDTL        60
     AHGALLGAAL ALALDISLYV AVVAVCLGLA AALSGLQRQR QLAGDTLLGI VAHTTLALGV       120
     IAISLQTGIQ VDLFAYLFGD LLAVGWQDVT GLWVGAMVIL MLMLWQWRAL LSITVNEELA       180
     QVEGIAVQRT RLLLMLLLAL LIAGAIRTVG VLLITSLLVI PAASARRLTH TPAQMAAVAS       240
     VLGTLSVLVG LAVSWYANTP VGPSIVVAAS SLFVLTLLRR GS                          282
//

If you have problems or comments...

PBIL Back to PBIL home page