(data stored in ACNUC1104 zone)

EMBL: AM420293.ACCA

AM420293.ACCA        Location/Qualifiers
FT   CDS             45467..47173
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="SACE_0026"
FT                   /product="acetyl carboxylase"
FT                   /function="Acetyl-CoA carboxylase alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99379"
FT                   /db_xref="GOA:A4F5Q5"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F5Q5"
FT                   /protein_id="CAL99379.1"
FT                   /translation="MAEPARTLAQDPRLADADQVRWTRCPNCRSLVYLRRLRRNGHVCP
FT                   DCAHHMRMGVHDRIESLLDAGSFERFGADVAPVDVLGFTDSRPYTERLAQAQRRSGSNE
FT                   AVLCGTGTIDGAPLVVAALDFGFLGGSVGGVTGELVARAARTALDRRTPLVLVCASGGA
FT                   RMQEGTISLMQMAKTSQEVARLHEAGVLVVSIGTDPTYGGVTASFGMLGDVVVAEPGAR
FT                   IGFAGPQVIRQTIRQELPAGFQTAEYLRDAGMVDLVVPRHELRAHLARLLRVHSGGTAA
FT                   PAAERGYRTRPRPAADRDASEVLHAARDIGRPSTSDYCARIFEDFVELHGDRVSGDDPA
FT                   VVAGIGTLGGRPVVVVGHQKGHETAELVQRNFGMPQPAGYHKARRMMDYAERFGFPLVT
FT                   FVDTPGAHPGVDAEQRGQGTAIAECISRMARLKVPAVSVVTGEGGSGGALALGVGNRVL
FT                   VLENAYYSVISPEGCSTILWGTAERTSQAAEQLRITAEDLLRLGVVDGVVDEPAGGAQQ
FT                   DHAAMASRLAAALRASIGELSELDGDALLDQRRRRFDRFGDPDHSDSEVQP"
     MAEPARTLAQ DPRLADADQV RWTRCPNCRS LVYLRRLRRN GHVCPDCAHH MRMGVHDRIE        60
     SLLDAGSFER FGADVAPVDV LGFTDSRPYT ERLAQAQRRS GSNEAVLCGT GTIDGAPLVV       120
     AALDFGFLGG SVGGVTGELV ARAARTALDR RTPLVLVCAS GGARMQEGTI SLMQMAKTSQ       180
     EVARLHEAGV LVVSIGTDPT YGGVTASFGM LGDVVVAEPG ARIGFAGPQV IRQTIRQELP       240
     AGFQTAEYLR DAGMVDLVVP RHELRAHLAR LLRVHSGGTA APAAERGYRT RPRPAADRDA       300
     SEVLHAARDI GRPSTSDYCA RIFEDFVELH GDRVSGDDPA VVAGIGTLGG RPVVVVGHQK       360
     GHETAELVQR NFGMPQPAGY HKARRMMDYA ERFGFPLVTF VDTPGAHPGV DAEQRGQGTA       420
     IAECISRMAR LKVPAVSVVT GEGGSGGALA LGVGNRVLVL ENAYYSVISP EGCSTILWGT       480
     AERTSQAAEQ LRITAEDLLR LGVVDGVVDE PAGGAQQDHA AMASRLAAAL RASIGELSEL       540
     DGDALLDQRR RRFDRFGDPD HSDSEVQP                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page