(data stored in ACNUC1104 zone)

EMBL: AM420293.ALGI

AM420293.ALGI        Location/Qualifiers
FT   CDS             498892..500325
FT                   /transl_table=11
FT                   /gene="algI"
FT                   /locus_tag="SACE_0446"
FT                   /product="alginate O-acetyltransferase"
FT                   /function="predicted membrane protein involved in D-alanine
FT                   export"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99794"
FT                   /db_xref="GOA:A4F6X0"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6X0"
FT                   /protein_id="CAL99794.1"
FT                   /translation="MSFASPLFLWYFLPLVLVAVLVAPRRARNAVVAAASLLFYASGAG
FT                   GTTLLLLACIVVNFVAGRFLEPDQWSAGQGRRKLLLIGTVTFDLLILALWKYAGFATEQ
FT                   AAVLASWFGGGFPVLQLALPIGISFYTFHHISYVVDIYRGERPALRDPVSFVTYIAMFP
FT                   QLVAGPIVRYREIADQLPQQRTHRLDDIAAGFPRFAWGLTKKVVIADTLAPMVDTAFAT
FT                   PAEDMTFAIAWLGAIGYAMQLYFDFSGYSDMAIGLGRMLGFRLPENFARPYSSVTVTEF
FT                   WRRWHMSLSRWFRDYVYIPLGGNRHGVAKTYRNLAIIFVLTGFWHGAAWTYLVWGLFHG
FT                   LMLVVERATGLDRAPSAPAARIGRRALTMLLVVVGWVFFRAPDLGTAFTMLGHMLVPDL
FT                   GGLGDIVSASVTNQRMFFLLVALVVVFLPANSGTGPFLESVRSRPANVLRVSVLTAGLA
FT                   YSGLLVATGSFSPFLYYQF"
     MSFASPLFLW YFLPLVLVAV LVAPRRARNA VVAAASLLFY ASGAGGTTLL LLACIVVNFV        60
     AGRFLEPDQW SAGQGRRKLL LIGTVTFDLL ILALWKYAGF ATEQAAVLAS WFGGGFPVLQ       120
     LALPIGISFY TFHHISYVVD IYRGERPALR DPVSFVTYIA MFPQLVAGPI VRYREIADQL       180
     PQQRTHRLDD IAAGFPRFAW GLTKKVVIAD TLAPMVDTAF ATPAEDMTFA IAWLGAIGYA       240
     MQLYFDFSGY SDMAIGLGRM LGFRLPENFA RPYSSVTVTE FWRRWHMSLS RWFRDYVYIP       300
     LGGNRHGVAK TYRNLAIIFV LTGFWHGAAW TYLVWGLFHG LMLVVERATG LDRAPSAPAA       360
     RIGRRALTML LVVVGWVFFR APDLGTAFTM LGHMLVPDLG GLGDIVSASV TNQRMFFLLV       420
     ALVVVFLPAN SGTGPFLESV RSRPANVLRV SVLTAGLAYS GLLVATGSFS PFLYYQF          477
//

If you have problems or comments...

PBIL Back to PBIL home page