(data stored in ACNUC1104 zone)

EMBL: AM420293.CLPC

AM420293.CLPC        Location/Qualifiers
FT   CDS             463959..466520
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="SACE_0414"
FT                   /product="putative ATP-dependent Clp protease"
FT                   /function="ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99762"
FT                   /db_xref="GOA:A4F6T8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6T8"
FT                   /protein_id="CAL99762.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVA
FT                   AKALESLGIALEGVRQQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIG
FT                   TEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVLQLLSGYQGKEPAEAGGRGEGTPSS
FT                   SLVLDQFGRNLTQSARESKLDPVIGREKEIERIMQVLSRRTKNNPVLIGEAGVGKTAVV
FT                   EGLAQKVVKGEVPETLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEIKTRGDIILF
FT                   IDEIHTLVGAGAAEGAIDAASILKPMLARGELQTIGATTLEEYRKYVEKDPALERRFQP
FT                   IQVGEPSLEHTIEILKGLRDRYEAHHRVSITDGALVSAATLADRYINDRFLPDKAIDLI
FT                   DEAGARMRIRRMTAPPDLREFDEKIADVRRDKESAIDAQDFERAARLRDEEKQLLGQKD
FT                   EREKQWKAGDLDVVAEVDDEQIAEVLANWTGIPVFKLTEEETTRLLRMEDELHKRIIGQ
FT                   DDAVKAVSQAIRRTRAGLKDPKRPSGSFIFAGPSGVGKTELSKALAEFLFGDDDALVQI
FT                   DMGEFHDRYTASRLFGAPPGYVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHQEIYNTLL
FT                   QVLEDGRLTDGQGRTVDFKNTVLIFTSNLGTQDISKAVGLGFSAGTDSESNYERMKSKV
FT                   NEEMKKHFRPEFLNRIDDVIVFHQLTEAEIIQMVDLLGARVEKALKGKDMSLELTTLAK
FT                   KLLAKRGFDPVLGARPLRRTIQREIEDRLSEKILFGEIEPGQIVIVDVEGWDGEGSDDK
FT                   AHFTFRGETKPSLVPDAPPVDLAGSTGSSTDDKSEGTSDQE"
     MFERFTDRAR RVVVLAQEEA RMLNHNYIGT EHILLGLIHE GEGVAAKALE SLGIALEGVR        60
     QQVEEIIGQG QQAPSGHIPF TPRAKKVLEL SLREALQLGH NYIGTEHILL GLIREGEGVA       120
     AQVLVKLGAD LNRVRQQVLQ LLSGYQGKEP AEAGGRGEGT PSSSLVLDQF GRNLTQSARE       180
     SKLDPVIGRE KEIERIMQVL SRRTKNNPVL IGEAGVGKTA VVEGLAQKVV KGEVPETLKD       240
     KQLYTLDLGS LVAGSRYRGD FEERLKKVLK EIKTRGDIIL FIDEIHTLVG AGAAEGAIDA       300
     ASILKPMLAR GELQTIGATT LEEYRKYVEK DPALERRFQP IQVGEPSLEH TIEILKGLRD       360
     RYEAHHRVSI TDGALVSAAT LADRYINDRF LPDKAIDLID EAGARMRIRR MTAPPDLREF       420
     DEKIADVRRD KESAIDAQDF ERAARLRDEE KQLLGQKDER EKQWKAGDLD VVAEVDDEQI       480
     AEVLANWTGI PVFKLTEEET TRLLRMEDEL HKRIIGQDDA VKAVSQAIRR TRAGLKDPKR       540
     PSGSFIFAGP SGVGKTELSK ALAEFLFGDD DALVQIDMGE FHDRYTASRL FGAPPGYVGY       600
     EEGGQLTEKV RRKPFSVVLF DEIEKAHQEI YNTLLQVLED GRLTDGQGRT VDFKNTVLIF       660
     TSNLGTQDIS KAVGLGFSAG TDSESNYERM KSKVNEEMKK HFRPEFLNRI DDVIVFHQLT       720
     EAEIIQMVDL LGARVEKALK GKDMSLELTT LAKKLLAKRG FDPVLGARPL RRTIQREIED       780
     RLSEKILFGE IEPGQIVIVD VEGWDGEGSD DKAHFTFRGE TKPSLVPDAP PVDLAGSTGS       840
     STDDKSEGTS DQE                                                          853
//

If you have problems or comments...

PBIL Back to PBIL home page