(data stored in SCRATCH zone)

EMBL: AM420293.CVNB1

AM420293.CVNB1       Location/Qualifiers
FT   CDS             762088..762528
FT                   /transl_table=11
FT                   /gene="cvnB1"
FT                   /locus_tag="SACE_0691"
FT                   /product="hypothetical protein"
FT                   /function="uncharacterized distant relative of homeotic
FT                   protein bithoraxoid"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0691"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00033"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7K9"
FT                   /protein_id="CAM00033.1"
FT                   /translation="MTAQETISRRFGWLVTDFTERVAGVAHAIVVSADGLLLTASAKLP
FT                   RDRADQLAAVASGLLSLTQGSAKCFEAGQVIQTVVEMQRGTLLQMGISDGSCLTVLAAP
FT                   QCDMGLIAYEMTMLVERVGQMLTPEIRSQLQGSPGAPTGQLV"
     MTAQETISRR FGWLVTDFTE RVAGVAHAIV VSADGLLLTA SAKLPRDRAD QLAAVASGLL        60
     SLTQGSAKCF EAGQVIQTVV EMQRGTLLQM GISDGSCLTV LAAPQCDMGL IAYEMTMLVE       120
     RVGQMLTPEI RSQLQGSPGA PTGQLV                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page