(data stored in ACNUC1104 zone)

EMBL: AM420293.CVNC6

AM420293.CVNC6       Location/Qualifiers
FT   CDS             762596..763090
FT                   /transl_table=11
FT                   /gene="cvnC6"
FT                   /locus_tag="SACE_0692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0692"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00034"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7L0"
FT                   /protein_id="CAM00034.1"
FT                   /translation="MLDGFTFTGGRKKRRDRRADRQQPEPAQEQEVLRPAPEPEAAPAP
FT                   PPVEPEAPAASSIRSYTWTGGRTRSNHQLELETLVSTGDAYQPDSVLRLEHQSIAELCR
FT                   HPRSVAEVGALLSIPIGVARVLLADMADLGLITVHQTVSESGSAPHLMLMERVLSGLRR
FT                   L"
     MLDGFTFTGG RKKRRDRRAD RQQPEPAQEQ EVLRPAPEPE AAPAPPPVEP EAPAASSIRS        60
     YTWTGGRTRS NHQLELETLV STGDAYQPDS VLRLEHQSIA ELCRHPRSVA EVGALLSIPI       120
     GVARVLLADM ADLGLITVHQ TVSESGSAPH LMLMERVLSG LRRL                        164
//

If you have problems or comments...

PBIL Back to PBIL home page