(data stored in ACNUC1104 zone)

EMBL: AM420293.CYDB

AM420293.CYDB        Location/Qualifiers
FT   CDS             169496..170506
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="SACE_0143"
FT                   /product="cytochrome d ubiquinol oxidase subunit II"
FT                   /function="Cytochrome bd-type quinol oxidase, subunit 2"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99496"
FT                   /db_xref="GOA:A4F622"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A4F622"
FT                   /protein_id="CAL99496.1"
FT                   /translation="MDLPTVWFCLIALLWLGYLFLEGFDFGVGMLLPFLGREESERRVM
FT                   INTIGPVWDGNEVWLIVAAGATFAAFPGWYASLLSTAYLPFLVLLLALIGRGVAFEYRG
FT                   KVDSDRWRRGWDTVIVLASWISPLVVGLVLSANVFGLPLDANGDRVGGLLGIFSLPSVV
FT                   GALAVCGFALLHGAFFVTLKTEGDLRVRARKFALRLGVPLLLPVTALVLIAQFTQGTAW
FT                   TWVPLVIAVLAAAAGFLRLRGWRDGQAFALQGVALAAVVVGLFGTLWPNVLPSTLDPAW
FT                   SLSVAGTASSPYTLAVITWVAAFGTPAVLVYQGWTYWVFRKRIGTKHIPKVHAPS"
     MDLPTVWFCL IALLWLGYLF LEGFDFGVGM LLPFLGREES ERRVMINTIG PVWDGNEVWL        60
     IVAAGATFAA FPGWYASLLS TAYLPFLVLL LALIGRGVAF EYRGKVDSDR WRRGWDTVIV       120
     LASWISPLVV GLVLSANVFG LPLDANGDRV GGLLGIFSLP SVVGALAVCG FALLHGAFFV       180
     TLKTEGDLRV RARKFALRLG VPLLLPVTAL VLIAQFTQGT AWTWVPLVIA VLAAAAGFLR       240
     LRGWRDGQAF ALQGVALAAV VVGLFGTLWP NVLPSTLDPA WSLSVAGTAS SPYTLAVITW       300
     VAAFGTPAVL VYQGWTYWVF RKRIGTKHIP KVHAPS                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page