(data stored in ACNUC1104 zone)

EMBL: AM420293.CYPA

AM420293.CYPA        Location/Qualifiers
FT   CDS             complement(264665..265870)
FT                   /transl_table=11
FT                   /gene="cypA"
FT                   /locus_tag="SACE_0229"
FT                   /product="cytochrome P450-like enzyme"
FT                   /function="Cytochrome P450"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99581"
FT                   /db_xref="GOA:A4F6A7"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6A7"
FT                   /protein_id="CAL99581.1"
FT                   /translation="MSIPADTWGIPASQFWLRGRRPERTVDYDAATGMWNVYGYPEIQH
FT                   VLSDPRTFSSDTTRLMPAKVAERTSALSEGSLLQMDPPEHTKLRKLVSHAFTPKVVADL
FT                   APRIADLANELLDDVGDRMEMVEDLAYPLPVIVIAELLGVPGSDRHLFKKWVDALLQRD
FT                   QQFSLVDESDEQVQQVEEAIAQVKHLTDYLGEHAAERRRAPREDLLTKLVQAEVDGHRL
FT                   SDTEVVNFANILLLAGHITTTMLLGNTVLCLDTHPRQRDAVRADRSLVPSAIEESLRFF
FT                   SPFAVLGRVTQREVEVGGQTIPQDQMLMLWIAAANRDPRQFADPDVFDVTRDPNPQIAF
FT                   GRGIHFCVGAPLARLEGKVALNILLDRFPHLRTDPDEGPTFLPAPTTTGVRKLPLLLTP
FT                   SA"
     MSIPADTWGI PASQFWLRGR RPERTVDYDA ATGMWNVYGY PEIQHVLSDP RTFSSDTTRL        60
     MPAKVAERTS ALSEGSLLQM DPPEHTKLRK LVSHAFTPKV VADLAPRIAD LANELLDDVG       120
     DRMEMVEDLA YPLPVIVIAE LLGVPGSDRH LFKKWVDALL QRDQQFSLVD ESDEQVQQVE       180
     EAIAQVKHLT DYLGEHAAER RRAPREDLLT KLVQAEVDGH RLSDTEVVNF ANILLLAGHI       240
     TTTMLLGNTV LCLDTHPRQR DAVRADRSLV PSAIEESLRF FSPFAVLGRV TQREVEVGGQ       300
     TIPQDQMLML WIAAANRDPR QFADPDVFDV TRDPNPQIAF GRGIHFCVGA PLARLEGKVA       360
     LNILLDRFPH LRTDPDEGPT FLPAPTTTGV RKLPLLLTPS A                           401
//

If you have problems or comments...

PBIL Back to PBIL home page