(data stored in ACNUC1104 zone)

EMBL: AM420293.DEF

AM420293.DEF         Location/Qualifiers
FT   CDS             complement(568180..568755)
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="SACE_0514"
FT                   /product="putative polypeptide deformylase"
FT                   /function="N-formylmethionyl-tRNA deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99860"
FT                   /db_xref="GOA:A4F736"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A4F736"
FT                   /protein_id="CAL99860.1"
FT                   /translation="MAVHPIRIVGDPVLHNPTRLVENFDDELRTLVDDMFETMAAASGV
FT                   GLAANQIGVDLRLFVYDCPDDEGVQHRGVVVNPVLETTEVPESMPDPEEDWEGCLSVPG
FT                   ESFPTGRADWAKVTGSDVDGNPVEVEGTGFFARCLQHETDHLDGFLYLSRLVGRHARAA
FT                   KKTVKRNGWGVPGMSWDPSEHGDPFADE"
     MAVHPIRIVG DPVLHNPTRL VENFDDELRT LVDDMFETMA AASGVGLAAN QIGVDLRLFV        60
     YDCPDDEGVQ HRGVVVNPVL ETTEVPESMP DPEEDWEGCL SVPGESFPTG RADWAKVTGS       120
     DVDGNPVEVE GTGFFARCLQ HETDHLDGFL YLSRLVGRHA RAAKKTVKRN GWGVPGMSWD       180
     PSEHGDPFAD E                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page