(data stored in SCRATCH zone)

EMBL: AM420293.DNAA

AM420293.DNAA        Location/Qualifiers
FT   CDS             1..1779
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="SACE_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /function="ATPase involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99356"
FT                   /db_xref="GOA:A4F5N2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5N2"
FT                   /protein_id="CAL99356.1"
FT                   /translation="MADHQADLGRVWEEVVQELSSGTLSPQQRAWMRVTRPIGLLDGTA
FT                   LLAAPSDFAKEAIERALREPITDALSRRLGRDVSLAVKVDTAVQAPSRPAPPPAESWPT
FT                   RDSITGPDRPTGFAEAGVSPYISTSSSYLQPPRTDSFTPPVTGSLPAVDNHYPTAEQPR
FT                   VVDYQSADYPTTEYHDWPTAAELTAGTPHEGESEAAPESDDEVDEEREAIDAANEIWPT
FT                   FGRGQAPEAQQGQPFTAPKHAPPTSQTRLNAKYTFDTFVIGASNRFAHAAAVAAAEAPA
FT                   RAYNPLFIWGESGLGKTHLLHAVGHYAQRLFPGMRVRYVSTEEFTNDFINSLRDDRQVA
FT                   FQRRYRDVDVLLVDDIQFLEGKEGTQEEFFHTFNTLHNSNKQIVVSSDRPPKGLRTLED
FT                   RLRTRFEWGLITDIQPPELETRIAILRKKAAQDRMNAPADVLEFIAARIERNIRELEGA
FT                   LIRVTAFASLNRQPVDVQLAEIVLRDLIPDSQTPEITAPTIMAVTADFFSVTIDDLCGP
FT                   GKTKALAQARQIAMYLCRELTDSSLPKIGQSFGGRDHTTVMHADKKIRKEMAERRRVYD
FT                   QVQELTSRIKQQSRGS"
     MADHQADLGR VWEEVVQELS SGTLSPQQRA WMRVTRPIGL LDGTALLAAP SDFAKEAIER        60
     ALREPITDAL SRRLGRDVSL AVKVDTAVQA PSRPAPPPAE SWPTRDSITG PDRPTGFAEA       120
     GVSPYISTSS SYLQPPRTDS FTPPVTGSLP AVDNHYPTAE QPRVVDYQSA DYPTTEYHDW       180
     PTAAELTAGT PHEGESEAAP ESDDEVDEER EAIDAANEIW PTFGRGQAPE AQQGQPFTAP       240
     KHAPPTSQTR LNAKYTFDTF VIGASNRFAH AAAVAAAEAP ARAYNPLFIW GESGLGKTHL       300
     LHAVGHYAQR LFPGMRVRYV STEEFTNDFI NSLRDDRQVA FQRRYRDVDV LLVDDIQFLE       360
     GKEGTQEEFF HTFNTLHNSN KQIVVSSDRP PKGLRTLEDR LRTRFEWGLI TDIQPPELET       420
     RIAILRKKAA QDRMNAPADV LEFIAARIER NIRELEGALI RVTAFASLNR QPVDVQLAEI       480
     VLRDLIPDSQ TPEITAPTIM AVTADFFSVT IDDLCGPGKT KALAQARQIA MYLCRELTDS       540
     SLPKIGQSFG GRDHTTVMHA DKKIRKEMAE RRRVYDQVQE LTSRIKQQSR GS               592
//

If you have problems or comments...

PBIL Back to PBIL home page