(data stored in SCRATCH zone)

EMBL: AM420293.DNAK

AM420293.DNAK        Location/Qualifiers
FT   CDS             complement(326975..328237)
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="SACE_0293"
FT                   /product="chaperone protein HscC"
FT                   /function="Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99642"
FT                   /db_xref="GOA:A4F6G8"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6G8"
FT                   /protein_id="CAL99642.1"
FT                   /translation="MLCRAQDGSYLAGEQAQRQELTHHQWVARGFTRRVGEDAPLLVGN
FT                   DFVQPHALAATMIEWVADAVAHRQGHPPEHIAVAHSANWGPHRTHVVHQALAQLGISDV
FT                   TLLPEPVAVAMDYASKQRVDDGGAIAVGNIGGTGFDATVLRRRTPGFEVVGPPLDSPHP
FT                   GGQDLDDALFEHIRAELGGLAGLDVTDFNVRATLAQLRGDCVHARETLSFHPGATLRIH
FT                   LPKVNTDFAVSRSRFEKLARTHLERVPELVLQAVQSANLTPGELDAVVLAGGVARTPLL
FT                   KQLVQERLERQPLVDGAPELVAACGAAVSAVKAVSTEGDQAASMAETSVLMRIEAPDDD
FT                   PNLLDPLDDDVAESPRPPVEVEPMHIEPPDEKRQRLFKILKLTLAALLVIAGLIMTFYG
FT                   TPSTGGLLGGAGGPAPQQQQR"
     MLCRAQDGSY LAGEQAQRQE LTHHQWVARG FTRRVGEDAP LLVGNDFVQP HALAATMIEW        60
     VADAVAHRQG HPPEHIAVAH SANWGPHRTH VVHQALAQLG ISDVTLLPEP VAVAMDYASK       120
     QRVDDGGAIA VGNIGGTGFD ATVLRRRTPG FEVVGPPLDS PHPGGQDLDD ALFEHIRAEL       180
     GGLAGLDVTD FNVRATLAQL RGDCVHARET LSFHPGATLR IHLPKVNTDF AVSRSRFEKL       240
     ARTHLERVPE LVLQAVQSAN LTPGELDAVV LAGGVARTPL LKQLVQERLE RQPLVDGAPE       300
     LVAACGAAVS AVKAVSTEGD QAASMAETSV LMRIEAPDDD PNLLDPLDDD VAESPRPPVE       360
     VEPMHIEPPD EKRQRLFKIL KLTLAALLVI AGLIMTFYGT PSTGGLLGGA GGPAPQQQQR       420
//

If you have problems or comments...

PBIL Back to PBIL home page