(data stored in ACNUC1104 zone)

EMBL: AM420293.DNAN

AM420293.DNAN        Location/Qualifiers
FT   CDS             3031..4155
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SACE_0003"
FT                   /product="DNA polymerase III beta subunit"
FT                   /function="DNA polymerase sliding clamp subunit (PCNA
FT                   homolog)"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99357"
FT                   /db_xref="GOA:A4F5N3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5N3"
FT                   /protein_id="CAL99357.1"
FT                   /translation="MKIRVERDGLADAVAWVARSLPSRPPVPVLGGVLLDASSGEALTI
FT                   SGFDYEVSAQVTIDASIDSTGRTLVSGRLLADITKALPNRPVEITVDGSRVTITCGSSR
FT                   FSLPTMPVEDYPELPAMPDHAGSVPGDLFSEAVSQVAVAAGKDDTLPMLTGVRMEINAD
FT                   RLTMVATDRFRLAMREFTWEPGTTIEDTSVLVPAKTLSDSAKTLGTGGNKVEISLASGD
FT                   GLLGLSGNSRRSTTRLLDAEFPKYRQLLPSESAVTAVVDVAPLVEAIKRVSLVAERGTQ
FT                   VRLEFSDAGLRLTAGGDDEGSAEEELPVELVGEALTIAFNPAYLLDGLGALKSDRAQML
FT                   FTTSNRPAVLKPVGEDGEVAEGYLYLLMPVRLPG"
     MKIRVERDGL ADAVAWVARS LPSRPPVPVL GGVLLDASSG EALTISGFDY EVSAQVTIDA        60
     SIDSTGRTLV SGRLLADITK ALPNRPVEIT VDGSRVTITC GSSRFSLPTM PVEDYPELPA       120
     MPDHAGSVPG DLFSEAVSQV AVAAGKDDTL PMLTGVRMEI NADRLTMVAT DRFRLAMREF       180
     TWEPGTTIED TSVLVPAKTL SDSAKTLGTG GNKVEISLAS GDGLLGLSGN SRRSTTRLLD       240
     AEFPKYRQLL PSESAVTAVV DVAPLVEAIK RVSLVAERGT QVRLEFSDAG LRLTAGGDDE       300
     GSAEEELPVE LVGEALTIAF NPAYLLDGLG ALKSDRAQML FTTSNRPAVL KPVGEDGEVA       360
     EGYLYLLMPV RLPG                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page