(data stored in ACNUC1104 zone)

EMBL: AM420293.EMBC

AM420293.EMBC        Location/Qualifiers
FT   CDS             205651..208779
FT                   /transl_table=11
FT                   /gene="embC"
FT                   /locus_tag="SACE_0178"
FT                   /product="probable arabinosyltransferase, membrane protein"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99530"
FT                   /db_xref="GOA:A4F656"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="InterPro:IPR040920"
FT                   /db_xref="InterPro:IPR042486"
FT                   /db_xref="UniProtKB/TrEMBL:A4F656"
FT                   /protein_id="CAL99530.1"
FT                   /translation="MNHPIGSAVLERPAEPGPERPERRSAPLWLAHFVALTVGLLGLVC
FT                   ALSLPFAPVWSDRTEVRWPSVHAGTPDAPGTGTTLDDGLRSTTALFAPYRPAEFHAAVP
FT                   CATLRSADGTVFSTLPPGSDREGMVLAVREGEPRLLLGQREVELPPLAGDCTLNVNADS
FT                   AQSVVTVGASTTRLPGVAAPEIFTFSTDLEPVQAATLSVTARTFSWFDTTPTEQKRGMV
FT                   TGALLMAALSLLFLVVTAPPAMSALRGAARLRTWLLLPVDAAVLGILAWWLVIGPISDD
FT                   DGFAMMTVRNFEPTGDIGNYYRWFNASETPFTLVQHTMRWFADHSLAPVWLRLPSVLAG
FT                   ALTWVVLSRGVVGPLCGPGSRLRAHLLAAVFFLACWLPFDLGVRPEAFVALGTTVLVAA
FT                   LLKAEHSAGPFAWLGLAAVAAGLTVAVTPTGVAALVIVLVFSPRIGRLVVRPGAVPAWL
FT                   AIPARIALVGCAGSVGLVAMFADSTWNGVAQATWLHDEFGPSLGWYQEFNRYNVLLGTT
FT                   HWGAAGKRLAVFLVVTAALIAAGCVLRGLHRSTRTPDVALLLGAVAAIFAALWLTPSKW
FT                   THHFGSLAGLGPALLAVTVVMLTRVRAPREARVLGVCGASAASLAAGLAFMGPNAWYLY
FT                   SDIAMPWSDAPVDPLDQPVLWLAVGVASGLVAYAVVLLSRRGEAEARQAWTTMPSSVLA
FT                   LAALASTIVLLGSFTTAYRETGDRFSVARTNWHSVTATSCGVEDEVETLPLAATLRALP
FT                   GAPEPDGFALSGSPPPEPDLDPESRKDGEVQPQEDVPPVWDSREGGPQNTGTLTTGWFE
FT                   LPALEPDQVLAIWVAGRPEQGNSLAVEFGTPIGDVVRELRDPPPTELPFDDPRHGRPVD
FT                   WRDFRPWRVMTVEAPAGARTVRLHAEDRTTDEQGWLAVSAPVVRDVVPLPEVLDAQGPT
FT                   LVDWPMGLLFPCRIDYPRVSGGTADSPGVLVAPPAGEASMAYAPDLGGVFAGVPMQSRR
FT                   IELPSRLRGAPGVRWGHVYAVSYDTERDVYDRHVTRIRIGGADGDGAYPFEEH"
     MNHPIGSAVL ERPAEPGPER PERRSAPLWL AHFVALTVGL LGLVCALSLP FAPVWSDRTE        60
     VRWPSVHAGT PDAPGTGTTL DDGLRSTTAL FAPYRPAEFH AAVPCATLRS ADGTVFSTLP       120
     PGSDREGMVL AVREGEPRLL LGQREVELPP LAGDCTLNVN ADSAQSVVTV GASTTRLPGV       180
     AAPEIFTFST DLEPVQAATL SVTARTFSWF DTTPTEQKRG MVTGALLMAA LSLLFLVVTA       240
     PPAMSALRGA ARLRTWLLLP VDAAVLGILA WWLVIGPISD DDGFAMMTVR NFEPTGDIGN       300
     YYRWFNASET PFTLVQHTMR WFADHSLAPV WLRLPSVLAG ALTWVVLSRG VVGPLCGPGS       360
     RLRAHLLAAV FFLACWLPFD LGVRPEAFVA LGTTVLVAAL LKAEHSAGPF AWLGLAAVAA       420
     GLTVAVTPTG VAALVIVLVF SPRIGRLVVR PGAVPAWLAI PARIALVGCA GSVGLVAMFA       480
     DSTWNGVAQA TWLHDEFGPS LGWYQEFNRY NVLLGTTHWG AAGKRLAVFL VVTAALIAAG       540
     CVLRGLHRST RTPDVALLLG AVAAIFAALW LTPSKWTHHF GSLAGLGPAL LAVTVVMLTR       600
     VRAPREARVL GVCGASAASL AAGLAFMGPN AWYLYSDIAM PWSDAPVDPL DQPVLWLAVG       660
     VASGLVAYAV VLLSRRGEAE ARQAWTTMPS SVLALAALAS TIVLLGSFTT AYRETGDRFS       720
     VARTNWHSVT ATSCGVEDEV ETLPLAATLR ALPGAPEPDG FALSGSPPPE PDLDPESRKD       780
     GEVQPQEDVP PVWDSREGGP QNTGTLTTGW FELPALEPDQ VLAIWVAGRP EQGNSLAVEF       840
     GTPIGDVVRE LRDPPPTELP FDDPRHGRPV DWRDFRPWRV MTVEAPAGAR TVRLHAEDRT       900
     TDEQGWLAVS APVVRDVVPL PEVLDAQGPT LVDWPMGLLF PCRIDYPRVS GGTADSPGVL       960
     VAPPAGEASM AYAPDLGGVF AGVPMQSRRI ELPSRLRGAP GVRWGHVYAV SYDTERDVYD      1020
     RHVTRIRIGG ADGDGAYPFE EH                                               1042
//

If you have problems or comments...

PBIL Back to PBIL home page