(data stored in ACNUC1104 zone)

EMBL: AM420293.FABF

AM420293.FABF        Location/Qualifiers
FT   CDS             671423..672571
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="SACE_0606"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /function="3-oxoacyl-(acyl-carrier-protein) synthase"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0606"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99951"
FT                   /db_xref="GOA:A4F7C7"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C7"
FT                   /protein_id="CAL99951.1"
FT                   /translation="MTDVVITGLGLVTPFGPGAGVFWEALRTGRCALAAPARFDLPSEH
FT                   GEPVGEVPPDAVVGVPRKRAYLAAALSEALESAGSSGLPDDALLVLVGQAPWEPGDDPD
FT                   WHEFVGPVQPRAARTTYLTHACASAAFGIGFARDAIRAGLTGTAVVAGGSALNRYEYAS
FT                   LQAVRAISRSAARPFDRARSGISIGEGGGAVVLEDASRAAARGAATDVLVAGACRRVGA
FT                   GKSAASDAGLIEECVREALADARVDRLDHVHAHATGTPQGDQAELAALEAVAAALGHDD
FT                   LPVSSHKGAIGHLLHVSCLPAVVAAVKALRTGETPPTAGLADPEPTKRLRLAPGRIPVD
FT                   EPATAAVTSFGFGSNNSTVVLARRPNQPAGHRRAEPIGRPTW"
     MTDVVITGLG LVTPFGPGAG VFWEALRTGR CALAAPARFD LPSEHGEPVG EVPPDAVVGV        60
     PRKRAYLAAA LSEALESAGS SGLPDDALLV LVGQAPWEPG DDPDWHEFVG PVQPRAARTT       120
     YLTHACASAA FGIGFARDAI RAGLTGTAVV AGGSALNRYE YASLQAVRAI SRSAARPFDR       180
     ARSGISIGEG GGAVVLEDAS RAAARGAATD VLVAGACRRV GAGKSAASDA GLIEECVREA       240
     LADARVDRLD HVHAHATGTP QGDQAELAAL EAVAAALGHD DLPVSSHKGA IGHLLHVSCL       300
     PAVVAAVKAL RTGETPPTAG LADPEPTKRL RLAPGRIPVD EPATAAVTSF GFGSNNSTVV       360
     LARRPNQPAG HRRAEPIGRP TW                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page