(data stored in SCRATCH zone)

EMBL: AM420293.FEPD

AM420293.FEPD        Location/Qualifiers
FT   CDS             460677..461747
FT                   /transl_table=11
FT                   /gene="fepD"
FT                   /locus_tag="SACE_0411"
FT                   /product="putative ferrichrome transport system permease
FT                   protein"
FT                   /function="ABC-type Fe3+-siderophore transport
FT                   system,permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99759"
FT                   /db_xref="GOA:A4F6T5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6T5"
FT                   /protein_id="CAL99759.1"
FT                   /translation="MSRSAIVGDPPEAAREPAAGGRLAARRRRRLVGIGVLAVLLLLSC
FT                   LLSVLLGAKPMSLEAVWSALFAPTGTENDLIVRELRVPRTIVGVLAGVALGLAGALMQG
FT                   HTRNPIADPGILGITHGAALGIVLSVYVFGITSLFGFIWFGFGGALLGALAVFAIGSIG
FT                   RGGPTPVTLALAGMAIGYLLQAITSALVLVDQQSLETYRFWKVGSIAVTDTSVIWQVLP
FT                   FLAVGVVVALANASGLNALSLGEDVARSLGHRVQWSRRLGIAAIAVLVGGAVAICGPIG
FT                   FVGLIVPHVARFFTGADYRWLLPFAALMGASVVLLADVLGRLVARPAEIQVGVMLAVVG
FT                   APFFIGLVRRRKLVRL"
     MSRSAIVGDP PEAAREPAAG GRLAARRRRR LVGIGVLAVL LLLSCLLSVL LGAKPMSLEA        60
     VWSALFAPTG TENDLIVREL RVPRTIVGVL AGVALGLAGA LMQGHTRNPI ADPGILGITH       120
     GAALGIVLSV YVFGITSLFG FIWFGFGGAL LGALAVFAIG SIGRGGPTPV TLALAGMAIG       180
     YLLQAITSAL VLVDQQSLET YRFWKVGSIA VTDTSVIWQV LPFLAVGVVV ALANASGLNA       240
     LSLGEDVARS LGHRVQWSRR LGIAAIAVLV GGAVAICGPI GFVGLIVPHV ARFFTGADYR       300
     WLLPFAALMG ASVVLLADVL GRLVARPAEI QVGVMLAVVG APFFIGLVRR RKLVRL           356
//

If you have problems or comments...

PBIL Back to PBIL home page